The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|682148.3.peg.1119: Gardnerella vaginalis 5-1

This feature in The SEED Viewer

NCBI Taxonomy Id: 682148

Current Assignment: Phage protein
Translate Function Assignments



Context on contig NZ_ADAN01000092 from base 143 to 8678 (8536 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1117 143 622 480 +           hypothetical protein locus|GV51_1079, protein_id|ZP_06977380.1, gi|298253791
1118 915 1223 309 + 292         rRNA biogenesis protein rrp5, putative locus|GV51_1080, protein_id|ZP_06977381.1, gi|298253792
1119 1180 2346 1167 + -44       Phage protein locus|GV51_1081, protein_id|ZP_06977382.1, gi|298253793
1120 2351 2899 549 + 4 12     Phage protein locus|GV51_1082, protein_id|ZP_06977383.1, gi|298253794
1121 3126 5102 1977 + 226 17     FIG006036: phage encoded DNA polymerase I (EC 2.7.7.7) locus|GV51_1084, protein_id|ZP_06977385.1, gi|298253796
1122 5200 5991 792 + 97         Phage antirepressor protein locus|GV51_1085, protein_id|ZP_06977386.1, gi|298253797
1123 6242 6358 117 + 250         hypothetical protein locus|GV51_1086, protein_id|ZP_06977387.1, gi|298253798
1124 6351 8678 2328 + -8 6     DNA primase, phage associated locus|GV51_1087, protein_id|ZP_06977388.1, gi|298253799

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|682148.3.peg.1119 Phage protein
MRAYCMKRRELKVTKHALLSPSSAHRWIKCTPSAVLEEKFENTTSAAAKEGTAAHAWCEY
KLNKLLNRPCEKPSTEYDSNEMQECSDAYVDFVMEKYEQAKLNCQDPILLIEQKVDFSAY
VPDGFGTADCIIVGDKTLQVIDFKYGQGVLVDAYENPQMKCYALGALTLFDSLYEIQTVE
MSIFQPRRDNVSTFTLPVAELICWAESVLKPKAGLAIKGEGEFEAGDWCRFCRAKAVCRK
RAEENLKLAEFEFKPPSVLTDSEIEEVLTLIPQLTKWADDVLAYATDSAINHGKEWSGFK
LVEGRSVRKFKDETAVIEKAKAHGFTDIFKTSLIGLTEMQKMMGKKKFEDILGDLVIKPS
GKLTLVPDSDKRAKVNVTNVNQEFKKEN

MD5 = 6bc2f70da0967390da9def9784be4438


  DNA Sequence

>fig|682148.3.peg.1119 Phage protein
atgagagcctattgcatgaagcggagggaattaaaggtgactaagcatgctttactttcc
ccatcttctgctcacaggtggattaagtgtactccgagtgctgttttagaagaaaagttt
gaaaacactacttctgctgcagcaaaggaaggaacggcagcacacgcgtggtgtgagtac
aagctgaataagcttcttaaccgtccgtgtgaaaaaccgtcaacagagtatgactcaaac
gagatgcaggaatgctcggatgcttacgtggatttcgtaatggaaaaatacgaacaggca
aaacttaactgtcaagatcctatccttctcatcgagcagaaagttgatttttcagcttac
gtgccggacgggtttggtacagcggactgcattattgtaggcgataaaacgctgcaggtt
atcgactttaagtacggtcaaggcgtgctggttgatgcttacgagaatcctcagatgaaa
tgctacgcgcttggagctttaacgcttttcgacagcttgtatgagattcaaactgttgag
atgagtatttttcagccgcggcgtgacaacgtatcaacttttacgctacctgtcgcggag
cttatctgttgggctgaaagcgtgcttaaacctaaagcagggcttgctattaaaggcgaa
ggcgaatttgaagccggtgactggtgcaggttttgcagggcaaaagcagtatgcagaaag
cgtgccgaggaaaatctaaagcttgcagaatttgagttcaaaccgccttctgttttaacg
gatagtgagattgaagaagtgctcacgcttattccacagttaacaaagtgggctgatgat
gttttagcgtacgccacagattccgctattaaccacggtaaagagtggagcggtttcaaa
ctcgtggaaggacgttctgttcgtaagtttaaggatgagacagcggttattgagaaagcg
aaagctcatggctttaccgacattttcaaaactagtcttatcggtttaacggaaatgcaa
aagatgatgggcaagaaaaaatttgaggatattctgggcgacctcgttataaaaccgtcc
ggaaaacttacgctcgtaccggactcggataagcgggcaaaagttaacgtaacaaatgta
aaccaagaattcaaaaaggagaattag


  DNA with Flanking Sequence

>fig|682148.3.peg.1119 Phage protein
tgatgtgtaaggaagaaaccccttatagaaaggaggcaaaactcgtgaaacacaagatcg
ttattaacgtcaccggtgaaaacggtgagaagaaacaggttctacgtggagctgtgatgc
gattacctcaacggtttatccgctggctgtttggtgattactcgcaagtctacctattag
atcctggaaagagtgttcagtcagttgatgtcaaagaagtttaaggaggaaaaccgtgaa
aaaggaaatattgagagaagttatcaaagacttggaaaacttaacagctcatcttaaaac
gctgtttgatgatgctggtgcttctggtgctggttgtaaagaaacagctcctaataataa
ggggtctgttaaaaaggtgagtttggaggatgtgcgagcggttttagcaaaacttagcca
gatgggaaagacagctgatgtgaagaaactcatcgttaagcacggtgcgcaaaagctatc
ggatgttcctgaaagcgagtatgagagcctattgcatgaagcggagggaattaaaggtga
ctaagcatgctttactttccccatcttctgctcacaggtggattaagtgtactccgagtg
ctgttttagaagaaaagtttgaaaacactacttctgctgcagcaaaggaaggaacggcag
cacacgcgtggtgtgagtacaagctgaataagcttcttaaccgtccgtgtgaaaaaccgt
caacagagtatgactcaaacgagatgcaggaatgctcggatgcttacgtggatttcgtaa
tggaaaaatacgaacaggcaaaacttaactgtcaagatcctatccttctcatcgagcaga
aagttgatttttcagcttacgtgccggacgggtttggtacagcggactgcattattgtag
gcgataaaacgctgcaggttatcgactttaagtacggtcaaggcgtgctggttgatgctt
acgagaatcctcagatgaaatgctacgcgcttggagctttaacgcttttcgacagcttgt
atgagattcaaactgttgagatgagtatttttcagccgcggcgtgacaacgtatcaactt
ttacgctacctgtcgcggagcttatctgttgggctgaaagcgtgcttaaacctaaagcag
ggcttgctattaaaggcgaaggcgaatttgaagccggtgactggtgcaggttttgcaggg
caaaagcagtatgcagaaagcgtgccgaggaaaatctaaagcttgcagaatttgagttca
aaccgccttctgttttaacggatagtgagattgaagaagtgctcacgcttattccacagt
taacaaagtgggctgatgatgttttagcgtacgccacagattccgctattaaccacggta
aagagtggagcggtttcaaactcgtggaaggacgttctgttcgtaagtttaaggatgaga
cagcggttattgagaaagcgaaagctcatggctttaccgacattttcaaaactagtctta
tcggtttaacggaaatgcaaaagatgatgggcaagaaaaaatttgaggatattctgggcg
acctcgttataaaaccgtccggaaaacttacgctcgtaccggactcggataagcgggcaa
aagttaacgtaacaaatgtaaaccaagaattcaaaaaggagaattagtattatgtctaaa
ttaaataacacgaaggttattacaggtaagaacacgcgtctttcctatttcaatggttgg
gagccaaagtctattaacggcggccctgaaaaatatagtgtttcactgcttatccctaaa
agtgatgttgaaacagtaaacgctattgagaaagctattgatgctgcgattgaggaaggt
gtcggtaagttcggtggtaaaaaaccaaacaaggctgctcttaaaacaccactcagggac
ggggatattgagcgtgatgatgaagcgtataaaggacattactttattaacgcgaactca
accacggctccgcagattgtagacaagcaggtaaaaccaatcatggatcgcagtgaagtg
tattcaggctgctatgcgagggtttccatcaatttttacgcgtttaactctaacggtaat
aagggagttgcttgtggtcttggcaatattcaaaagattagagacggtgagccactcggc
ggacgta


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
12 fig|682148.3.peg.1120 Phage protein
17 fig|682148.3.peg.1121 FIG006036: phage encoded DNA polymerase I (EC 2.7.7.7)
6 fig|682148.3.peg.1124 DNA primase, phage associated


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search