The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|670904.4.peg.698: Escherichia coli OK1180

This feature in The SEED Viewer

NCBI Taxonomy Id: 670904

Current Assignment: Roi protein
Translate Function Assignments



Context on contig ADUQ01000038 from base 16 to 4234 (4219 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
697 144 16 129 -           hypothetical protein  
698 954 475 480 - 330         Roi protein locus|ECOK1180_0724, protein_id|EFZ66013.1, gi|323180465
699 1198 1037 162 - 82         Phage DNA binding protein Roi locus|ECOK1180_0725, protein_id|EFZ66014.1, gi|323180466
700 1977 1273 705 - 74         putative antirepressor protein locus|ECOK1180_0726, protein_id|EFZ66015.1, gi|323180467
701 2958 2431 528 - 453         Phage DNA N-6-adenine methyltransferase locus|ECOK1180_0727, protein_id|EFZ66016.1, gi|323180468
702 3068 2955 114 - -4         Protein NinB  
703 3261 3061 201 - -8         Protein NinB locus|ECOK1180_0729, protein_id|EFZ66018.1, gi|323180470
704 3595 3359 237 - 97         hypothetical protein locus|ECOK1180_0730, protein_id|EFZ66019.1, gi|323180471
705 3821 3606 216 - 10         hypothetical protein  
706 4234 3998 237 - 176         hypothetical protein locus|ECOK1180_0731, protein_id|EFZ66020.1, gi|323180472

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|670904.4.peg.698 Roi protein
MSPEFTARLVDRWRELEGATAKIPQTFSEALRLAADLEDQKAELEKQLALAAPKVEFADR
VGEASGILIGNFAKVVGIGPNKRFAWMRDHKILIASGARRNVPMQEYMDRGYFTVKETAV
NTNHGIQISFTTKITGRGQQWLTRKLLDNGMLKVTGEAA

MD5 = 81f252a67b1ac6660c391a6538de32fb


  DNA Sequence

>fig|670904.4.peg.698 Roi protein
ttgtcgccggaattcaccgctcgccttgttgaccgctggcgagaactcgaaggggcaacc
gcgaaaataccacaaaccttttctgaggcattgcgccttgcggccgaccttgaagaccag
aaggctgaactggagaaacagcttgctctcgcagcacctaaagttgagtttgccgatcga
gttggcgaggccagcggaattttgattggaaactttgcaaaggttgttggtattggtcca
aacaaacggtttgcgtggatgcgcgatcacaaaatccttattgcttcaggtgcccggcgc
aatgtgccaatgcaggaatatatggatcgcggctatttcacagtgaaagaaacagcggtc
aatacaaatcacggaatacagatatcgttcaccacaaaaatcaccgggcgtggtcaacag
tggctgacaagaaagctgctagataacggaatgcttaaagtaacaggggaggctgcttaa


  DNA with Flanking Sequence

>fig|670904.4.peg.698 Roi protein
actattccggcagatgctacgactacggtcatgagttttcgtatgttatcggaatggcga
gagatgttttaatcaaccacacacgagatgttgatattaatgagccagacggaccaacga
acctttccgcatgggtaaggcttaagaacaaagagttgccgccttcactgcatcgctact
gacaattgacaacttaacaaacccagcttcggctgggttttttattactgaattttcaat
gtgagaggacatgacaatgaatgagctgataaatagcagtatcatcaaaatgacaagcat
tgaaatcgctgagttagtgggaagtcgtccagataacgtaaaaatatcaatagagcgcct
ggctaaatctggagttattcaacttcctgcattgcaggttttcgaaaaaaatcaataact
tagggctgcgccgtagtgtcgaggcttacgtcttcgaaggcgaacaaggtaagcgcgata
gcattattgtcgttgcccagttgtcgccggaattcaccgctcgccttgttgaccgctggc
gagaactcgaaggggcaaccgcgaaaataccacaaaccttttctgaggcattgcgccttg
cggccgaccttgaagaccagaaggctgaactggagaaacagcttgctctcgcagcaccta
aagttgagtttgccgatcgagttggcgaggccagcggaattttgattggaaactttgcaa
aggttgttggtattggtccaaacaaacggtttgcgtggatgcgcgatcacaaaatcctta
ttgcttcaggtgcccggcgcaatgtgccaatgcaggaatatatggatcgcggctatttca
cagtgaaagaaacagcggtcaatacaaatcacggaatacagatatcgttcaccacaaaaa
tcaccgggcgtggtcaacagtggctgacaagaaagctgctagataacggaatgcttaaag
taacaggggaggctgcttaatggctaaaccagcgcgaaggaaatgcaaaatctgtaagga
atggtttcacccggcattctcaaatcagtggtggtgcagcccggaacacggaactaaatt
agcactcgaacgacgaaataaagaacgcgaaaaggcggaaaaaacagcagagaagaaacg
acgacgagaggagcagaaacagaaagataaaattaagattcgaaaactcgccttaaagcc
ccgcagttactggattaaacaagcccaacaagccgtaaacgccttcatcagagaaagaga
ccgcgacttaccatgtatctcgtgcggaacgctcacgtctgctcagtgggatgccggaca
ttaccggacaactgctgcggcacctcaactccgatttgatgaacgcaatattcacaagca
atgcgtggtgtgcaaccagcacaaaagcggaaatctcgttccgtatcgcgtcgaactgat
taatcgcatcgggc


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search