The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|644279.4.peg.1634: Staphylococcus aureus subsp. aureus 132

This feature in The SEED Viewer

NCBI Taxonomy Id: 644279

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig NZ_ACOT01000030 from base 136523 to 149864 (13342 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1624 138484 136523 1962 -   4     DNA polymerase I (EC 2.7.7.7)  
1625 139100 138543 558 - 58         Phage protein  
1626 140292 139126 1167 - 25         Phage protein  
1627 140651 140289 363 - -4         Phage protein  
1628 140989 140666 324 - 14         Phage protein  
1629 141229 141068 162 - 78         Phage phi 11 orf10a protein homolog  
1630 141505 141242 264 - 12         Phage protein  
1631 141747 141532 216 - 26         Phage protein  
1632 141802 142167 366 + 54         Phage protein  
1633 142649 142431 219 - 263         ORF065  
1634 143441 142665 777 - 15       Phage antirepressor protein  
1635 143694 143467 228 - 25         ORF060  
1636 143866 144480 615 + 171         Phage repressor protein cI  
1637 144496 145416 921 + 15         Phage DNA helicase (EC 3.6.4.12)  
1638 145512 145694 183 + 95         Phage protein  
1639 145731 145853 123 + 36         Phage protein  
1640 146463 145840 624 - -14         FIG081523: hypothetical protein within a prophage  
1641 146589 147794 1206 + 125 5     Phage integrase  
1642 149864 147837 2028 - 42         hypothetical protein within a prophage  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|644279.4.peg.1634 Phage antirepressor protein
MQALQTFNFEELPVRTLTVDNEPYFVGKDVAEILGYSNTRDALSKHVDEDDKEILTSRNT
TLENLPNRGLTAVNESGLYSLIFSSKLESAKRFKRWVTSDVLPAIRKHGIYATDSVIENT
LNNPDYIINILTEYKKEKEQNLLLQQEMGELKPKADYVDEILKSTGTLATTQIAADYGIS
AQKLNKLLHEARLQRKVNKQWVLYSEHMGKSYTESDTIPIVRSDGREDTVLQTRWTQKGR
LKIHEIMTEFGYEANVTA

MD5 = 6ab6dbf00fd7d6a42b7f3b3d97e5a547


  DNA Sequence

>fig|644279.4.peg.1634 Phage antirepressor protein
atgcaagcattacaaacatttaattttgaagaattaccagtaagaacattaacagtagat
aacgaaccatattttgtaggtaaagatgtggcagaaatcttaggatactcgaatacgcgt
gacgcattaagtaaacacgttgatgaagacgataaggaaattctaacgtcgcgaaacacg
actttagaaaatttgccaaatcgaggacttactgcagtcaacgaatcaggtttatacagc
ttaatcttctcatcaaaactagagtcagcaaaacgattcaaacgatgggtaacatcagac
gtcctaccagccattcgcaaacacggtatctacgcaacagacagtgtaattgagaacacg
ctgaacaatccagattacatcattaacattcttactgagtataagaaagaaaaagagcaa
aacttactattacagcaagaaatgggagagttgaagcctaaagcagattatgttgatgaa
atcttaaaatcaactggcacattagctacaactcagattgcagcagactatgggatttca
gcacaaaagttaaacaaactactacacgaagctagattacaacgaaaagtaaataaacag
tgggtgctttactcagaacacatgggcaagagttacacagaatcagacactataccaatt
gtacgctctgacggtagagaagacacagtgctacaaactagatggacgcaaaaaggcaga
ttaaaaatacacgaaatcatgactgaatttggttatgaagctaacgtaacagcttaa


  DNA with Flanking Sequence

>fig|644279.4.peg.1634 Phage antirepressor protein
ctacaccaactaaatctccaacttgttctagagttaaattcaattctttacgtctgcttt
taatgtctggtttcattttaaatttcctcctaataggtatgtactgaatataacactgaa
gtttcttaaaagcaacacttatataggaagtaaaaataaaaatgtatttttagacacttt
tgtgttgactagattgatattagcatgtatcattgaagtatcctaaaagacacggaggtg
ttgaaaaatgaacaaagcgaaactttattctgctttagcgatgaaagagatgcatgtaaa
tgattttttaaaagaattgaataatcatggtttaaaactttctaaaagcgcttattatag
tagaattagaggagaacaagaatttgacatcaaagaaattaagacgatagtcaaagttct
taatttaaccagagaagaaatgaacgatattttttttggagaattggtgtcctaaaagac
acttgaggaggcataaacaaatgcaagcattacaaacatttaattttgaagaattaccag
taagaacattaacagtagataacgaaccatattttgtaggtaaagatgtggcagaaatct
taggatactcgaatacgcgtgacgcattaagtaaacacgttgatgaagacgataaggaaa
ttctaacgtcgcgaaacacgactttagaaaatttgccaaatcgaggacttactgcagtca
acgaatcaggtttatacagcttaatcttctcatcaaaactagagtcagcaaaacgattca
aacgatgggtaacatcagacgtcctaccagccattcgcaaacacggtatctacgcaacag
acagtgtaattgagaacacgctgaacaatccagattacatcattaacattcttactgagt
ataagaaagaaaaagagcaaaacttactattacagcaagaaatgggagagttgaagccta
aagcagattatgttgatgaaatcttaaaatcaactggcacattagctacaactcagattg
cagcagactatgggatttcagcacaaaagttaaacaaactactacacgaagctagattac
aacgaaaagtaaataaacagtgggtgctttactcagaacacatgggcaagagttacacag
aatcagacactataccaattgtacgctctgacggtagagaagacacagtgctacaaacta
gatggacgcaaaaaggcagattaaaaatacacgaaatcatgactgaatttggttatgaag
ctaacgtaacagcttaataggaggacttaaaaatgaatgaagaaaaagtaaaagtagtac
aacaagttttaggacaagttgaacaagaaataagctttgctcttggtacagatgaaggat
cacaaatcaaaaagaaaattgaacataacggtagggaatacgaaatctatatgacaagag
aagaatgtttagaagataccttgattgaaattactaaactactagaagcaattaatttcg
ggttttattaaaacaaattaaaccccaatcgaacaaacatcttaaaaggaggaataacaa
atgaacattcaagaagcaactaagatagctacaaaaaatcttgtctctatgacacggaaa
gattggaaagaaagtcatcgaactaagatattaccaacaaatgatagttttttacaatgc
atcatttcaaatagcgatgggacaaaccttatcagatattggcaaccttcagccgatgac
ctcatggcaaatgattgggaagttataaacccaacta


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
fig|320839.3.peg.37 Bacteriophage 47 FIG   Phage antirepressor protein
fig|585148.3.peg.1062 Staphylococcus aureus subsp. aureus Btn1260 FIG   Phage antirepressor protein
fig|585151.3.peg.1472 Staphylococcus aureus subsp. aureus C427 FIG   Phage antirepressor protein
gb|AAX91208.1 Bacteriophage 47     ORF017
gi|62636097 Bacteriophage 47 NCBI   ORF017
gi|66395673 Staphylococcus phage 47 NCBI   ORF017
img|638314457 Bacteriophage 47 IMG   ORF017
ref|YP_240038.1 Staphylococcus phage 47 RefSeq   ORF017
tr|Q4ZCI8 Staphylococcus phage 47 TrEMBL   ORF017


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|644279.4.peg.1624 DNA polymerase I (EC 2.7.7.7)
5 fig|644279.4.peg.1641 Phage integrase


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search