The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|642492.3.peg.828: Clostridium lentocellum DSM 5427

This feature in The SEED Viewer

NCBI Taxonomy Id: 642492

Current Assignment: BRO, N-terminal
Translate Function Assignments



Context on contig NZ_ADVF01000004 from base 203027 to 212758 (9732 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
822 203027 204685 1659 +       2: 1 2   Ribonuclease J2 (endoribonuclease in RNA processing) locus|CloleDRAFT_0868, protein_id|ZP_06882782.1, gi|296440702, InterPro:IPR001587, InterPro:IPR004613, InterPro:IPR011108
823 204702 204914 213 + 16         hypothetical protein locus|CloleDRAFT_0869, protein_id|ZP_06882783.1, gi|296440703
824 206645 205548 1098 - 633         Phage integrase locus|CloleDRAFT_0870, protein_id|ZP_06882784.1, gi|296440704, InterPro:IPR002104, InterPro:IPR011010, InterPro:IPR013762
825 207202 206771 432 - 125         hypothetical protein locus|CloleDRAFT_0871, protein_id|ZP_06882785.1, gi|296440705, InterPro:IPR010359
826 207377 207225 153 - 22         helix-turn-helix domain protein locus|CloleDRAFT_0872, protein_id|ZP_06882786.1, gi|296440706, InterPro:IPR001387, InterPro:IPR010982
827 207909 208115 207 + 531         hypothetical protein locus|CloleDRAFT_0873, protein_id|ZP_06882787.1, gi|296440707, InterPro:IPR001387, InterPro:IPR010982
828 208367 209197 831 + 251         BRO, N-terminal locus|CloleDRAFT_0875, protein_id|ZP_06882789.1, gi|296440709, InterPro:IPR005039, InterPro:IPR019104
829 209197 209373 177 + -1         hypothetical protein locus|CloleDRAFT_0876, protein_id|ZP_06882790.1, gi|296440710
830 209655 210425 771 + 281         hypothetical protein locus|CloleDRAFT_0878, protein_id|ZP_06882792.1, gi|296440712, InterPro:IPR011741
831 210931 210509 423 - 83         hypothetical protein  
832 210995 211243 249 + 63         hypothetical protein locus|CloleDRAFT_0881, protein_id|ZP_06882795.1, gi|296440715
833 211731 211916 186 + 487         hypothetical protein locus|CloleDRAFT_0884, protein_id|ZP_06882798.1, gi|296440718
834 212327 212758 432 + 410         DNA polymerase III beta chain locus|CloleDRAFT_0886, protein_id|ZP_06882800.1, gi|296440720, InterPro:IPR001001

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|642492.3.peg.828 BRO, N-terminal
MNKELNQALATGNNTPVVLIGKNGQAIETISSIEVSEMVEKPHNDLLKDIRRYITQLAEG
NLSHSEFFIESTYLDANRQSRTCYQVTRKGCELIANKLIGTKGTCFTARYVNRFHSMENY
IKQKESYQIDDPIERAKAWILEQQEKQVLQLENKQQQQIIGELQPKASYYDLVLQSTELM
PITLIAKDYGMSANAMNKTLFNLNVQYNQSGTWLLYAKHHAKGYTQSKTQTYTRGDGSTG
IKLHTQWTQKGRLFLYSLLKENGILPVIEREDGGQA

MD5 = 449a7a791835c8007f5b5017796d37ed


  DNA Sequence

>fig|642492.3.peg.828 BRO, N-terminal
atgaataaagaattaaatcaggcattggctacaggtaataatactccagtagtgctaatc
ggtaaaaatggacaagctattgaaactataagcagcatagaagtatcagaaatggtagaa
aagccacacaacgatttattaaaggatattagaagatatattactcaattagccgaggga
aatctttcccacagcgaattctttattgaaagtacatatttagatgcaaatagacaaagt
agaacatgttatcaagttactagaaaaggttgcgaactaattgcaaacaagcttatagga
acaaagggcacatgttttacagcaagatatgtaaatagatttcatagcatggaaaactac
ataaaacaaaaagaatcatatcagattgatgatcccattgaacgtgctaaagcttggata
ttagaacagcaagaaaagcaagtattacaactagaaaataagcagcaacagcagataatc
ggcgagcttcaacctaaagcatcctattacgatttagtattacaaagtacggaactcatg
cctattactttaatagctaaagactacggcatgagtgcaaatgcaatgaataaaacacta
tttaatctaaatgttcagtataaccaatcaggtacatggcttttatatgcaaagcatcac
gctaaaggatacacacaatcaaagacacaaacttatacaagaggtgatggttcaactgga
attaagcttcatactcagtggacacaaaaaggaagactatttctttattctttattaaaa
gaaaatgggattttaccagttatagaacgtgaagatggaggacaagcataa


  DNA with Flanking Sequence

>fig|642492.3.peg.828 BRO, N-terminal
tattatgcttaaaaaataaacaattaaaaggaggaatgtatcatggcaagatgcgtgact
aggaaatacacaacttttggtaaagaagtggctaagaaactgattgatttagacatgaac
aactcagatttagctaaaaaaattggtgtaagtcccatgtatatatcagacatcttacaa
gggaagagaatagctacggagcgcaagaaacaaatagctgaaatattaggactaacgatt
gctatttaaaggaggtacatatatgtcaaaaaagcatgtttacagtgtaaaggaagctgc
aaaaaaattagatgtatgtgaaatgactatatatcgaaaggttaaaaccaatgaaatccc
tgcaaaaagggttggtaaagctatacgtatacctgcgcaatatattgacgatttctataa
taatccaattagtgatgttcaaaagtttatttttggttaaaacaacaatttgattaagta
aagaaagagaggtactaaagatgaataaagaattaaatcaggcattggctacaggtaata
atactccagtagtgctaatcggtaaaaatggacaagctattgaaactataagcagcatag
aagtatcagaaatggtagaaaagccacacaacgatttattaaaggatattagaagatata
ttactcaattagccgagggaaatctttcccacagcgaattctttattgaaagtacatatt
tagatgcaaatagacaaagtagaacatgttatcaagttactagaaaaggttgcgaactaa
ttgcaaacaagcttataggaacaaagggcacatgttttacagcaagatatgtaaatagat
ttcatagcatggaaaactacataaaacaaaaagaatcatatcagattgatgatcccattg
aacgtgctaaagcttggatattagaacagcaagaaaagcaagtattacaactagaaaata
agcagcaacagcagataatcggcgagcttcaacctaaagcatcctattacgatttagtat
tacaaagtacggaactcatgcctattactttaatagctaaagactacggcatgagtgcaa
atgcaatgaataaaacactatttaatctaaatgttcagtataaccaatcaggtacatggc
ttttatatgcaaagcatcacgctaaaggatacacacaatcaaagacacaaacttatacaa
gaggtgatggttcaactggaattaagcttcatactcagtggacacaaaaaggaagactat
ttctttattctttattaaaagaaaatgggattttaccagttatagaacgtgaagatggag
gacaagcataatgagtaaaaaagcaaaggaactaaagcaacaaaaaagagatgctattac
atctactttacaagctaagatgagggccaatagagaaaaggtacatgaatgcttaagagt
aggagatagtgcaggagcaagccattacagttctttaaatactcagttaagggggctatt
aaaatgaaaaaccttcttaaagagatattagcagctattgcactaatagtagcatttacg
ctcgttttatttccaccttcattatcatcagatgaagtcaaaataatcttaggcttacca
agtgtaatttttctcagcttttacatgggagtgtatattaccaaacgtgaacgttacaaa
agagaatttgaaaagaaaaaaagcatggcaaaggcggcaacctttaaccatgcacataga
aaataaaatttcaagatgatattaacacgaaaggagtgaatatgcaatatgtcagatgcg
attaacagggcatattactctattattccag


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search