The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|634994.3.peg.765: Leptotrichia hofstadii F0254

This feature in The SEED Viewer

NCBI Taxonomy Id: 634994

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig NZ_GG700632 from base 436591 to 448461 (11871 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
753 436591 436848 258 +           hypothetical protein  
754 437084 436851 234 - 2         hypothetical protein  
755 437175 437387 213 + 90         hypothetical protein  
756 437400 437591 192 + 12         hypothetical protein  
757 437859 438659 801 + 267         hypothetical protein  
758 438661 439311 651 + 1         Replicative DNA helicase( EC:3.6.1.- )  
759 439404 439937 534 + 92         hypothetical protein  
760 440173 440526 354 + 235         hypothetical protein  
761 440529 440813 285 + 2         hypothetical protein  
762 440810 441001 192 + -4         putative secreted protein  
763 441156 441326 171 + 154         hypothetical protein  
764 441443 441730 288 + 116         hypothetical protein  
765 441743 442516 774 + 12         Phage antirepressor protein  
766 442516 442722 207 + -1         hypothetical protein  
767 442886 443068 183 + 163         hypothetical protein  
768 443035 443757 723 + -34         hypothetical protein  
769 443754 444038 285 + -4         hypothetical protein  
770 444452 445309 858 + 413         hypothetical protein  
771 445441 445605 165 + 131         hypothetical protein  
772 446126 446695 570 + 520         hypothetical protein  
773 446655 447128 474 + -41         Terminase large subunit  
774 447176 447490 315 + 47         Phage terminase, large subunit  
775 447487 448461 975 + -4         Terminase large subunit  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|634994.3.peg.765 Phage antirepressor protein
MRNELTVFENEKFGKVRVVTENEKPYFNLNDVCEILGLKNPRQVKSRLNPKGVILVDTLT
SGGKQQMNFINESNLYKCIFQSDKPEAEAITEWVTGEVLPTIRKTGMYVTDELLNNPDLA
IKAFTRLKEEQEKRMRLEKEIEEQAPAVAFANSLTVSKDCILVRELSKILKQNGIDVGET
RLFEWLRQNGYLISKVGSDWNLPTQKSMNLGLFVIKEGTRMSTTEGSKITKTPKVTGKGQ
QYFLNKFLKNNRLMEVN

MD5 = 4ade481fe7d45277fe4685b6b20b3575


  DNA Sequence

>fig|634994.3.peg.765 Phage antirepressor protein
atgagaaatgaattaacagtatttgaaaatgaaaaattcggaaaagtaagagtagttaca
gaaaatgaaaaaccttatttcaatttaaatgatgtatgcgagattttaggattaaaaaat
cctagacaagtaaaatcaagactaaatccaaagggcgtcattttggtggacacccttaca
agtggcggaaaacagcaaatgaattttataaatgaaagtaatttatataaatgtatattc
caaagtgataaacctgaagcagaagcaattacagagtgggtaacaggagaggtattgcca
acaatcagaaaaacaggaatgtatgtaacagatgaactattaaataatcctgatttagct
ataaaagcctttacgagattgaaagaagagcaggagaaaagaatgcgtttagaaaaagaa
atagaagagcaagctccagcagtcgcttttgcaaattccttgacagtatccaaagattgt
attttagttagagagctatcaaaaatattaaagcaaaatggaattgatgttggagaaacg
agattatttgagtggttaagacaaaatggatatttaatttcaaaagtaggctctgattgg
aatttgcccacacaaaaatcaatgaatctagggctattcgtgataaaagaaggcactagg
atgtcaacaacagagggttcaaaaattacaaaaactccaaaagtaacaggaaaaggacag
caatatttcctgaataaatttttaaaaaataacagacttatggaggtaaattaa


  DNA with Flanking Sequence

>fig|634994.3.peg.765 Phage antirepressor protein
aaattaggcgttacaccagaagatagaaccgttgaattgtttttcgatgaagaaaacaac
cagttaatattgaaaaagaaataaaaaatctcctaaaatccttttagttagactttagga
gaatacagtacaataagcacctcacaaccttattatactgtataaactccaaaaaatcaa
tatttttaggaggaaaaattatgacttttgaacaaaaattaggatttgaagtagcgaagg
aaatgcttgacacacacaatggagaattgcagaaggcaaaagatgaattttttgaagtgt
ttggagaaatttgggaaaaggcaaaagaaaaaggaatcaaaatgtttgacttggaagaag
ccttatataattacttagatacaatcaaggaagagtactataaagctggaagagcaattg
acggtgtagttgaaagagaaactttaaaaaacgaagtggcaaaagccaagaaaaagaaaa
tagtataatggaggataaaaatgagaaatgaattaacagtatttgaaaatgaaaaattcg
gaaaagtaagagtagttacagaaaatgaaaaaccttatttcaatttaaatgatgtatgcg
agattttaggattaaaaaatcctagacaagtaaaatcaagactaaatccaaagggcgtca
ttttggtggacacccttacaagtggcggaaaacagcaaatgaattttataaatgaaagta
atttatataaatgtatattccaaagtgataaacctgaagcagaagcaattacagagtggg
taacaggagaggtattgccaacaatcagaaaaacaggaatgtatgtaacagatgaactat
taaataatcctgatttagctataaaagcctttacgagattgaaagaagagcaggagaaaa
gaatgcgtttagaaaaagaaatagaagagcaagctccagcagtcgcttttgcaaattcct
tgacagtatccaaagattgtattttagttagagagctatcaaaaatattaaagcaaaatg
gaattgatgttggagaaacgagattatttgagtggttaagacaaaatggatatttaattt
caaaagtaggctctgattggaatttgcccacacaaaaatcaatgaatctagggctattcg
tgataaaagaaggcactaggatgtcaacaacagagggttcaaaaattacaaaaactccaa
aagtaacaggaaaaggacagcaatatttcctgaataaatttttaaaaaataacagactta
tggaggtaaattaatggaaaatctagaaatacaatttgaagaaaatttggccaaaacact
agaagtattagcaaaacaaaaaggaattactgtaaaagataaagttgacggcgaaaatct
tttatatgaatacattgcgtttgaattagcagcacctacaaacctctttgatgaaataaa
agaatttttgaatagtaaaattgatgaaatgtttaaataaaaaataataaagttcacagt
tattaatttagctgtgattttttttatgtgaaaatcaaaaaaatgaggaaattttataac
aattaacaaaatattcgttttaaaatgaaaaaaataactaaattttacattttaaatcaa
aaacaattgattatggaggaaaaatggatgaaaaagagaaaacattcaaaagaataaaag
aaaagatattatgtaatacagaaatgaacaaccgtgactttgagtttgcgaaacttaacg
ccaatttatttaagggtattaaatttatcaagaa


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search