The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|622312.4.peg.161: Roseburia inulinivorans DSM 16841

This feature in The SEED Viewer

NCBI Taxonomy Id: 622312

Current Assignment: BRO-like protein
Translate Function Assignments



Context on contig NZ_ACFY01000004 from base 42553 to 53086 (10534 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
152 43512 42553 960 -           TrsK-like protein locus|ROSEINA2194_00167, protein_id|ZP_03751773.1, gi|225374552, InterPro:IPR003688
153 43991 43509 483 - -4         DUF3801 protein locus|ROSEINA2194_00168, protein_id|ZP_03751774.1, gi|225374553
154 44645 44010 636 - 18         hypothetical protein locus|ROSEINA2194_00169, protein_id|ZP_03751775.1, gi|225374554
155 45162 44656 507 - 10         hypothetical protein locus|ROSEINA2194_00170, protein_id|ZP_03751776.1, gi|225374555
156 46000 45176 825 - 13     3: 2 1 3   Chromosome (plasmid) partitioning protein ParB locus|ROSEINA2194_00171, protein_id|ZP_03751777.1, gi|225374556, InterPro:IPR003115, InterPro:IPR004437
157 46163 46017 147 - 16         hypothetical protein  
158 47005 46160 846 - -4     1: 4   Phage DNA helicase loader locus|ROSEINA2194_00172, protein_id|ZP_03751778.1, gi|225374557, InterPro:IPR002611, InterPro:IPR015793
159 47676 47002 675 - -4 9     hypothetical protein locus|ROSEINA2194_00173, protein_id|ZP_03751779.1, gi|225374558
160 47824 47657 168 - -20         hypothetical protein locus|ROSEINA2194_00174, protein_id|ZP_03751780.1, gi|225374559
161 48408 47821 588 - -4       BRO-like protein locus|ROSEINA2194_00175, protein_id|ZP_03751781.1, gi|225374560, InterPro:IPR003497
162 50441 49230 1212 - 821         hypothetical protein locus|ROSEINA2194_00177, protein_id|ZP_03751783.1, gi|225374562, InterPro:IPR002104, InterPro:IPR010998, InterPro:IPR011010, InterPro:IPR013762
163 51806 50589 1218 - 147         hypothetical protein locus|ROSEINA2194_00178, protein_id|ZP_03751784.1, gi|225374563, InterPro:IPR002104, InterPro:IPR011010, InterPro:IPR013762
164 52121 51894 228 - 87         hypothetical protein locus|ROSEINA2194_00179, protein_id|ZP_03751785.1, gi|225374564, InterPro:IPR009061
165 53086 52673 414 - 551         hypothetical protein locus|ROSEINA2194_00181, protein_id|ZP_03751787.1, gi|225374566, InterPro:IPR013249, InterPro:IPR013324

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|622312.4.peg.161 BRO-like protein
MNQYGDAGEQVVEISFITEGDVYRLIVHSKLPSAERFEHWVFDEVLPSIRKHGVYMSDSI
LDQVIQHPEVIYTLAQELVAEREQLEGIRKQLDAAQPKADYFDTFVNSEDCTCIRNFCKE
IGIPEKTAVALLLDHRYLYRSPSGWLMPFADKSARGYFIVRDCYGRSGKLVQQTRVTCKG
KNHLFKLFKKWGVIE

MD5 = a017082acd79e1c3b5c5b9ecd65677b0


  DNA Sequence

>fig|622312.4.peg.161 BRO-like protein
gtgaatcagtatggagatgctggagagcaggtcgttgaaatctcctttatcacagaaggc
gatgtttaccggctgatcgttcacagcaagctgccatcggcagaacgatttgaacactgg
gtgtttgatgaagttctcccgtccattcgcaagcatggtgtgtatatgagcgattccatt
ttggatcaggtgattcagcatccggaggtcatctacacactggcacaggagcttgtagcc
gagagagagcagcttgagggtatccgcaaacagctggatgcggcacagcccaaggcagac
tacttcgacacctttgtaaattcggaagattgcacctgcatccggaatttctgtaaggaa
atcggaatcccagagaagacggcagtagctctcttactggatcaccgctatctgtaccgc
agtccaagcggctggctgatgccttttgcagacaaatctgcaaggggctattttattgtc
cgggattgctacggcagaagtggaaaactggtgcagcagacgagagtgacctgcaaggga
aagaatcatctctttaagttgtttaagaaatggggtgtgatcgaatga


  DNA with Flanking Sequence

>fig|622312.4.peg.161 BRO-like protein
atgggtttacagaaggccattttggaggggaaattagccccatatccttgacagattttc
ggcaaaaatccggctgaaacggaatgaaaaacagtgtcaggttcgtttggcgagttctga
cgaattctgcaaaaatttaatatcaggtatcctgttacatagagccttggctcattcttt
gaaaacgagaatgggtcgaggctctatttttttcgcccgaaatccggcgagacaaatttg
agcaggaggtaacaggtatgacggatttcaatcagaagacccatgacaccgatgtgggca
gtcatggcggacagtcaaggcagatgatggaggtgtttgagaaccaggagtttggttcga
tccgcgtgttgcaagaggcgggcaagaccttcttctgtgcaagcgatgtggcgaaagcgt
tggggtatgtgaatccctacgccgcagtgaaacgccattgcagaggccccctaacgaaac
gcgagggggtcgttcagaaggtgaatcagtatggagatgctggagagcaggtcgttgaaa
tctcctttatcacagaaggcgatgtttaccggctgatcgttcacagcaagctgccatcgg
cagaacgatttgaacactgggtgtttgatgaagttctcccgtccattcgcaagcatggtg
tgtatatgagcgattccattttggatcaggtgattcagcatccggaggtcatctacacac
tggcacaggagcttgtagccgagagagagcagcttgagggtatccgcaaacagctggatg
cggcacagcccaaggcagactacttcgacacctttgtaaattcggaagattgcacctgca
tccggaatttctgtaaggaaatcggaatcccagagaagacggcagtagctctcttactgg
atcaccgctatctgtaccgcagtccaagcggctggctgatgccttttgcagacaaatctg
caaggggctattttattgtccgggattgctacggcagaagtggaaaactggtgcagcaga
cgagagtgacctgcaagggaaagaatcatctctttaagttgtttaagaaatggggtgtga
tcgaatgacgctttttacagagggacgccttcaggcgtttgaacgcatgatgcaggatac
cggcaaataccatcgacgggaggacagcgaagatcgtccgcgcaaatgtccgaagaaaaa
aacggagcctgcgaaaaaggatggtgagcaccatgccggtattcagggttgagaaaaaca
gcaattacacaacgatgtgcaattaccacctgcgggatcagggtctcagcctgaaaggaa
aaggacttctctccatgctgcttagtttaccggacacatggaactattcggtacgggggt
tatcttcgattacgccggatggcgtagatggagtgcttacggctctgaaggagctggagc
gtcttgggtatctggaaaggaaccagcagcgtgagagtaacggtcggatgggcagagcgg
agtatgtgatttatgagatgccaaggaaaaagccgtgttcggaatcaccgtgtacggaaa
agccgtatgcggtaaatccggatacgga


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
9 fig|622312.4.peg.159 hypothetical protein


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search