The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|596326.3.peg.2602: Lactobacillus jensenii 208-1

This feature in The SEED Viewer

NCBI Taxonomy Id: 596326

Current Assignment: Integrase
Translate Function Assignments



Context on contig NZ_ADEX01000182 from base 9064 to 20592 (11529 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2593 9064 9483 420 +           FIG00742661: hypothetical protein locus|HMPREF0886_0705, protein_id|ZP_06339670.1, gi|282934406
2594 9826 9629 198 - 145         Dna binding protein, phage associated locus|HMPREF0886_0706, protein_id|ZP_06339671.1, gi|282934407
2595 10176 9859 318 - 32         Phage related protein locus|HMPREF0886_0707, protein_id|ZP_06339672.1, gi|282934408
2596 10325 10834 510 + 148         FIG00745094: hypothetical protein locus|HMPREF0886_0708, protein_id|ZP_06339673.1, gi|282934409
2597 11492 10881 612 - 46 5     Phage antirepressor protein locus|HMPREF0886_0709, protein_id|ZP_06339674.1, gi|282934410
2598 12275 11796 480 - 303 4     Phage antirepressor protein locus|HMPREF0886_0710, protein_id|ZP_06339675.1, gi|282934411
2599 12692 12399 294 - 123 4     putative antirepressor locus|HMPREF0886_0711, protein_id|ZP_06339676.1, gi|282934412
2600 13134 12943 192 - 250         Phage antirepressor locus|HMPREF0886_0712, protein_id|ZP_06339677.1, gi|282934413
2601 13456 13773 318 + 321         putative transcriptional regulator locus|HMPREF0886_0713, protein_id|ZP_06339678.1, gi|282934414
2602 14347 15432 1086 + 573       Integrase locus|HMPREF0886_0715, protein_id|ZP_06339680.1, gi|282934416
rna.49 15602 15526 77 - 93         tRNA-Arg-TCT  
2603 15766 16122 357 + 163         Arsenate reductase and related proteins, glutaredoxin family locus|HMPREF0886_0717, protein_id|ZP_06339681.1, gi|282934417
2604 16134 18512 2379 + 11         Xaa-Pro dipeptidyl-peptidase locus|HMPREF0886_0718, protein_id|ZP_06339682.1, gi|282934418
2605 18803 19366 564 + 290         FIG00743640: hypothetical protein locus|HMPREF0886_0719, protein_id|ZP_06339683.1, gi|282934419
2606 20592 19414 1179 - 47         Permeases of the major facilitator superfamily locus|HMPREF0886_0720, protein_id|ZP_06339684.1, gi|282934420

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|596326.3.peg.2602 Integrase
MAQIIKKDNGWTIRYSHRVGKSLSQKYKSGFKTKAEAQAYIAKLEQMKQAGLKFDVNPSL
VEYYQNWVDTYKKAKVTLSTYQDYQLNGKRLENYFGKTKMKNITRSAYQEFINDFGNNHA
KNTVHKLNNCVKSCVQSALYDGIITKDFTHNINISFNADKALKVEYLSIAQIKALINYET
KTRKPLRPNNYLIIAALYSGARLSELTGLTWNDIDVYGNTFSISKTWNYRTKQFGPTKNE
SSVRKISVPKKLIDLLLELKVNRSDFVFWSATHQGLPNSHTANKALKRALDSLNIAKRDF
HFHSLRHCHVAFLLSQGIPIDGIAKRLGHANVITTMKIYAYLIDEYRNNLSNQIVDNLNA
L

MD5 = ffeb056e3126652c7d40b2c74eda82e1


  DNA Sequence

>fig|596326.3.peg.2602 Integrase
atggcacaaattattaaaaaagacaatggttggactataagatattcacatcgtgttgga
aaatctttaagtcagaaatacaaatcaggttttaaaactaaagctgaagcacaagcatat
attgctaagcttgaacagatgaaacaagcaggactaaagtttgatgtaaatcctagctta
gttgaatattatcaaaactgggtagatacttacaaaaaagccaaagttacactatctact
tatcaggattatcagctaaatggtaagcgccttgaaaactactttggcaaaactaaaatg
aaaaacataactcgatcagcctatcaagaatttattaacgattttggaaacaatcatgct
aaaaatactgtacacaagttaaataattgtgttaagtcttgcgtgcagtcagcactttat
gacggaattattaccaaagacttcacacacaacattaatatatcttttaatgctgataaa
gccttgaaagttgaatatctaagcatagctcaaattaaagcattgataaactacgaaact
aaaacacgaaagccacttagaccaaacaattacttaataattgctgcactctattctgga
gcacgattgagtgagcttactggattaacctggaatgatattgacgtgtatggtaatact
tttagtatttctaaaacctggaactatagaaccaagcaatttggaccaacaaaaaatgag
agtagtgttcgcaagatatcagtaccaaaaaagctaattgatttactactggaactaaaa
gttaaccgctcagactttgttttctggtctgcaactcaccaaggattgccaaactcgcac
acagctaataaggcgctaaaacgtgcgcttgattctcttaatattgctaagcgtgatttt
cactttcactcgctaagacactgccatgttgcctttcttttatctcaaggcatccccatt
gatggtatagcaaaacggttaggacatgctaatgtgatcacaactatgaaaatttatgca
tacttaattgatgaatatcgtaacaatttaagtaatcaaattgtggataacttaaatgcg
ttgtaa


  DNA with Flanking Sequence

>fig|596326.3.peg.2602 Integrase
agttcttcaagtgttgctcttagaagtgtcgttataaacttaaatgcagataatgttccc
ttacagtttgcacatgaattagggcatgttcttaatgaagatgatggtgttctttatttc
accacctctactaatggaagtagtgctgaatcaaatgctacaaaaacagggataaaatta
ttacttgattattattttagagaagtacctatagaagaaattaatttgagcaattttatg
agcttttacaaaataccattattatttaccgattatgtatactctttaaaattgcaataa
aaaaagacaatccatgaggaatgcctttctctacatcattggtcgcagtcttatgaaaga
aatatctattattataaactaaacaaagataaaacggtagtcaaatataaaataaaaaaa
gaccgccaaaatggcggtctttttgtcccttctataactttttagggtattcagtatata
aaataaaggacgtgattattatggcacaaattattaaaaaagacaatggttggactataa
gatattcacatcgtgttggaaaatctttaagtcagaaatacaaatcaggttttaaaacta
aagctgaagcacaagcatatattgctaagcttgaacagatgaaacaagcaggactaaagt
ttgatgtaaatcctagcttagttgaatattatcaaaactgggtagatacttacaaaaaag
ccaaagttacactatctacttatcaggattatcagctaaatggtaagcgccttgaaaact
actttggcaaaactaaaatgaaaaacataactcgatcagcctatcaagaatttattaacg
attttggaaacaatcatgctaaaaatactgtacacaagttaaataattgtgttaagtctt
gcgtgcagtcagcactttatgacggaattattaccaaagacttcacacacaacattaata
tatcttttaatgctgataaagccttgaaagttgaatatctaagcatagctcaaattaaag
cattgataaactacgaaactaaaacacgaaagccacttagaccaaacaattacttaataa
ttgctgcactctattctggagcacgattgagtgagcttactggattaacctggaatgata
ttgacgtgtatggtaatacttttagtatttctaaaacctggaactatagaaccaagcaat
ttggaccaacaaaaaatgagagtagtgttcgcaagatatcagtaccaaaaaagctaattg
atttactactggaactaaaagttaaccgctcagactttgttttctggtctgcaactcacc
aaggattgccaaactcgcacacagctaataaggcgctaaaacgtgcgcttgattctctta
atattgctaagcgtgattttcactttcactcgctaagacactgccatgttgcctttcttt
tatctcaaggcatccccattgatggtatagcaaaacggttaggacatgctaatgtgatca
caactatgaaaatttatgcatacttaattgatgaatatcgtaacaatttaagtaatcaaa
ttgtggataacttaaatgcgttgtaaaaaattcacaaactttttcaaaaaaaagttgcaa
taaagttgcaattttaaaaaaataaggcttagagcaatcgctctaagccttgatattact
ggtgattcgggtgagattcgaactcacgacccacggtttagaagaccgttgctctatcca
gctgagctaccgaaccgcatcagcaacataaattattatatgtgattgctttttatgtgt
caactaaaatttgataaaataatttgataatattcttccctattaccaattaaattgttt
tctaaattcttcaaaaaatattactatattattaaatgattcctaaaggagatacgctta
tgaaattttatggatatcgtcgttgctctacctcaaataaggcacaaaaatatcttgatg
aacataatgtcgattacgaatttgtagacattacccaaaatccaccaactgaagctgaat
tccaaacttggctttcaaagtatcaggatcgtggcttacgctactt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|575607.3.peg.1540 Lactobacillus jensenii SJ-7A-US FIG   Integrase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
5 fig|596326.3.peg.2597 Phage antirepressor protein
4 fig|596326.3.peg.2598 Phage antirepressor protein
4 fig|596326.3.peg.2599 putative antirepressor


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search