The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|596326.3.peg.2600: Lactobacillus jensenii 208-1

This feature in The SEED Viewer

NCBI Taxonomy Id: 596326

Current Assignment: Phage antirepressor
Translate Function Assignments



Context on contig NZ_ADEX01000182 from base 7417 to 18512 (11096 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2590 7947 7417 531 -           FIG00749920: hypothetical protein locus|HMPREF0886_0703, protein_id|ZP_06339668.1, gi|282934404
2591 8317 8138 180 - 190         hypothetical protein locus|HMPREF0886_0704, protein_id|ZP_06339669.1, gi|282934405
2592 8360 8701 342 + 42         hypothetical protein  
2593 9064 9483 420 + 362         FIG00742661: hypothetical protein locus|HMPREF0886_0705, protein_id|ZP_06339670.1, gi|282934406
2594 9826 9629 198 - 145         Dna binding protein, phage associated locus|HMPREF0886_0706, protein_id|ZP_06339671.1, gi|282934407
2595 10176 9859 318 - 32         Phage related protein locus|HMPREF0886_0707, protein_id|ZP_06339672.1, gi|282934408
2596 10325 10834 510 + 148         FIG00745094: hypothetical protein locus|HMPREF0886_0708, protein_id|ZP_06339673.1, gi|282934409
2597 11492 10881 612 - 46         Phage antirepressor protein locus|HMPREF0886_0709, protein_id|ZP_06339674.1, gi|282934410
2598 12275 11796 480 - 303         Phage antirepressor protein locus|HMPREF0886_0710, protein_id|ZP_06339675.1, gi|282934411
2599 12692 12399 294 - 123         putative antirepressor locus|HMPREF0886_0711, protein_id|ZP_06339676.1, gi|282934412
2600 13134 12943 192 - 250         Phage antirepressor locus|HMPREF0886_0712, protein_id|ZP_06339677.1, gi|282934413
2601 13456 13773 318 + 321         putative transcriptional regulator locus|HMPREF0886_0713, protein_id|ZP_06339678.1, gi|282934414
2602 14347 15432 1086 + 573         Integrase locus|HMPREF0886_0715, protein_id|ZP_06339680.1, gi|282934416
rna.49 15602 15526 77 - 93         tRNA-Arg-TCT  
2603 15766 16122 357 + 163         Arsenate reductase and related proteins, glutaredoxin family locus|HMPREF0886_0717, protein_id|ZP_06339681.1, gi|282934417
2604 16134 18512 2379 + 11         Xaa-Pro dipeptidyl-peptidase locus|HMPREF0886_0718, protein_id|ZP_06339682.1, gi|282934418

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|596326.3.peg.2600 Phage antirepressor
MPEMEPGRNKIKQFLKDNGISIAELAVSYGITRQELSQVLSGYRSRPKDNKLILKIISDL
GIK

MD5 = 92d0b9fadef3a3d10fe2e67854ebb466


  DNA Sequence

>fig|596326.3.peg.2600 Phage antirepressor
atgcctgaaatggaaccagggcgcaataaaatcaagcaattcttgaaagataacggcatt
agcattgctgaattagcagtttcgtatggaattactagacaagagttatctcaagtatta
agtggttatcgttcccgtcctaaagacaacaagttaattctgaagattatttcagatttg
ggaattaaataa


  DNA with Flanking Sequence

>fig|596326.3.peg.2600 Phage antirepressor
ataacatagccagttgttacatgcatcgctttagaaaccttattaagatttttaatagac
ggctttttatacttccatccataaattgttgaggcactaacattagctttttcagctaat
tcttggatactaatgccgtgttcacgacaccatctccttatattttcaaattcatccata
atatttaattactccttttttagttataggataaaaaaggataaaatatttcacaaaaat
tattgactttttgcctcttgtaaattaatataagtctgtaagctaaaatcgaaacaaaaa
acaagtatatttttgagcctttattatcctttaataaaaatagtaatataaaaaagcatc
attacttggcggtatttgctttatttactatacccttatattacaactaaggaataataa
gtcaatagtaaattgctctatttttattacttgcttatttacatttttgtttacaaataa
acaacaaagaggtgagcagtatgcctgaaatggaaccagggcgcaataaaatcaagcaat
tcttgaaagataacggcattagcattgctgaattagcagtttcgtatggaattactagac
aagagttatctcaagtattaagtggttatcgttcccgtcctaaagacaacaagttaattc
tgaagattatttcagatttgggaattaaataagggatgtccatgatacccctgcaagaaa
tgaatgctcgaattataaaacagtctaagtttaacttagatcgtcaaaactaccaaaaag
gtacttttgaataaatgatgaacgaaacgttcaccgacaaaaaggatgccccgatttagg
gcaacctagctgaagtatcaaaatggtatctaaggtcaaattaactgggtcggcaaatca
cgacggtattacaaaagaaaaaacgaaagcgagggaaatcatatgactgatttacaaatt
ttcaattttaacggtgcggatatcagaacgctaactattgatggggaaccatattttgtt
ggaaaagatgttgctgaaattcttggatatgcaattccgactaaagctgttactgatcat
gttgataaagaagatagaaaaacagaaatcttgaatacaactgagcttttccaaaatgga
aataatgtgaaagaatcacaagcgccccaaaacaggacaaatgtgaaaaaat


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|575605.3.peg.390 Lactobacillus jensenii 115-3-CHN FIG   Phage antirepressor
fig|575606.3.peg.404 Lactobacillus jensenii 27-2-CHN FIG   Phage antirepressor
fig|575607.3.peg.1537 Lactobacillus jensenii SJ-7A-US FIG   Phage antirepressor
fig|596326.3.peg.1486 Lactobacillus jensenii 208-1 FIG   Phage antirepressor


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search