The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|596326.3.peg.2598: Lactobacillus jensenii 208-1

This feature in The SEED Viewer

NCBI Taxonomy Id: 596326

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig NZ_ADEX01000182 from base 6315 to 18512 (12198 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2589 7067 6315 753 -   5     Replication protein O locus|HMPREF0886_0702, protein_id|ZP_06339667.1, gi|282934403
2590 7947 7417 531 - 349         FIG00749920: hypothetical protein locus|HMPREF0886_0703, protein_id|ZP_06339668.1, gi|282934404
2591 8317 8138 180 - 190         hypothetical protein locus|HMPREF0886_0704, protein_id|ZP_06339669.1, gi|282934405
2592 8360 8701 342 + 42         hypothetical protein  
2593 9064 9483 420 + 362         FIG00742661: hypothetical protein locus|HMPREF0886_0705, protein_id|ZP_06339670.1, gi|282934406
2594 9826 9629 198 - 145         Dna binding protein, phage associated locus|HMPREF0886_0706, protein_id|ZP_06339671.1, gi|282934407
2595 10176 9859 318 - 32         Phage related protein locus|HMPREF0886_0707, protein_id|ZP_06339672.1, gi|282934408
2596 10325 10834 510 + 148         FIG00745094: hypothetical protein locus|HMPREF0886_0708, protein_id|ZP_06339673.1, gi|282934409
2597 11492 10881 612 - 46         Phage antirepressor protein locus|HMPREF0886_0709, protein_id|ZP_06339674.1, gi|282934410
2598 12275 11796 480 - 303       Phage antirepressor protein locus|HMPREF0886_0710, protein_id|ZP_06339675.1, gi|282934411
2599 12692 12399 294 - 123         putative antirepressor locus|HMPREF0886_0711, protein_id|ZP_06339676.1, gi|282934412
2600 13134 12943 192 - 250         Phage antirepressor locus|HMPREF0886_0712, protein_id|ZP_06339677.1, gi|282934413
2601 13456 13773 318 + 321         putative transcriptional regulator locus|HMPREF0886_0713, protein_id|ZP_06339678.1, gi|282934414
2602 14347 15432 1086 + 573         Integrase locus|HMPREF0886_0715, protein_id|ZP_06339680.1, gi|282934416
rna.49 15602 15526 77 - 93         tRNA-Arg-TCT  
2603 15766 16122 357 + 163         Arsenate reductase and related proteins, glutaredoxin family locus|HMPREF0886_0717, protein_id|ZP_06339681.1, gi|282934417
2604 16134 18512 2379 + 11         Xaa-Pro dipeptidyl-peptidase locus|HMPREF0886_0718, protein_id|ZP_06339682.1, gi|282934418

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|596326.3.peg.2598 Phage antirepressor protein
MPAIRKHGGYLTDKKIEEALYNPDTLIKLATQLKEEREGRLIAEQQVAELKPKASYLDEI
LENKELITVSVIAKDYGMSAMEFNKLLHNLKVQFKQGKNWLLYSSYQSLGWTSSSTNQVT
KKDGSTMNVMNTKWTQKGRLGLYELLKRHDILPMIERVE

MD5 = b09051dabbf406fcc8ba08fb53fda5ed


  DNA Sequence

>fig|596326.3.peg.2598 Phage antirepressor protein
ttgccagctatccgtaagcatggtggatatcttacagataaaaagatcgaagaagcttta
tataatccagatactttaattaagctagctactcaacttaaagaagaacgtgaaggcaga
ttgattgctgaacaacaagttgctgaattaaaacctaaggctagttacttagatgaaatt
ttggaaaataaagaactaattactgtatcagtaattgctaaggactatggaatgagtgca
atggaatttaataagctccttcacaatcttaaagttcaatttaagcaaggaaagaattgg
cttttatatagcagttatcaaagccttggttggacttcatcaagcactaatcaagtaact
aaaaaagatggttcaaccatgaatgtaatgaatactaagtggactcaaaaaggacgatta
ggtttatatgaactacttaaaagacatgacattttaccaatgattgagagagtagagtaa


  DNA with Flanking Sequence

>fig|596326.3.peg.2598 Phage antirepressor protein
aaaatggtatctaaggtcaaattaactgggtcggcaaatcacgacggtattacaaaagaa
aaaacgaaagcgagggaaatcatatgactgatttacaaattttcaattttaacggtgcgg
atatcagaacgctaactattgatggggaaccatattttgttggaaaagatgttgctgaaa
ttcttggatatgcaattccgactaaagctgttactgatcatgttgataaagaagatagaa
aaacagaaatcttgaatacaactgagcttttccaaaatggaaataatgtgaaagaatcac
aagcgccccaaaacaggacaaatgtgaaaaaatcacaaaaattccaaaatggaaataatg
tgaaaaaatcacaatagtcgcaaaacgctacgggatatcaaaatattgatctaattacag
aatctggtgtttattcattaatctttgcaagcaagttaccaactgccaagaaattcaaac
actgggtaactagtgaagtcttgccagctatccgtaagcatggtggatatcttacagata
aaaagatcgaagaagctttatataatccagatactttaattaagctagctactcaactta
aagaagaacgtgaaggcagattgattgctgaacaacaagttgctgaattaaaacctaagg
ctagttacttagatgaaattttggaaaataaagaactaattactgtatcagtaattgcta
aggactatggaatgagtgcaatggaatttaataagctccttcacaatcttaaagttcaat
ttaagcaaggaaagaattggcttttatatagcagttatcaaagccttggttggacttcat
caagcactaatcaagtaactaaaaaagatggttcaaccatgaatgtaatgaatactaagt
ggactcaaaaaggacgattaggtttatatgaactacttaaaagacatgacattttaccaa
tgattgagagagtagagtaaataattacctttttaaaggggtcgctaaaatggagacacc
tcaataacaaatcgttattgagataaaaagcgtcgcaaatcacgacggtattaaaaggag
gaacgcaaatgagcgaattacaaatttttaattttaatggcgaaaatattagaacactaa
ctattgacgaagaaccgtatttcgtagggaaagacgtggctgaggtgcttgggtataaaa
atactaaagatgcccttatacgtcatgtcgccgatgacgataaaagggggtcgcaaatca
cgaccccctcaggaagacaaactatgactgtaattagtgagtcaggcttgtatagcttaa
ttctttcaagcaagttaccaacagccaagaaattcaagcactgggtaactagtgaagttc
tgccagctatccgcaaacacggtgcttatatgactgatgaaaaggcatttgatgttgtta
acaataaatcaggtttagctgatttacttcaacaagctgc


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
5 fig|596326.3.peg.2589 Replication protein O


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search