The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|585397.7.peg.2551: Escherichia coli ED1a

This feature in The SEED Viewer

NCBI Taxonomy Id: 585397

Current Assignment: Phage DNA binding protein Roi
Translate Function Assignments



Context on contig NC_011745 from base 2475348 to 2485986 (10639 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2546 2477330 2475348 1983 -           hypothetical protein  
2547 2478386 2478222 165 - 891         FIG00644438: hypothetical protein  
2548 2478814 2478383 432 - -4         hypothetical protein  
rna.45 2479057 2478983 75 - 168         tRNA-Pseudo-GTT  
2549 2479312 2479121 192 - 63         Phage antitermination protein Q  
2550 2480288 2479683 606 - 370 4     Protein NinG  
2551 2481010 2480288 723 - -1       Phage DNA binding protein Roi  
2552 2481546 2481085 462 - 74         putative antirepressor protein  
2553 2482783 2482256 528 - 709         Phage DNA N-6-adenine methyltransferase  
2554 2483085 2482780 306 - -4         Protein NinB  
2555 2483608 2483435 174 - 349         unknown protein encoded within prophage CP-933V  
2556 2484021 2483731 291 - 122         Ren protein  
2557 2484719 2484018 702 - -4         Origin specific replication binding factor  
2558 2485654 2484716 939 - -4         Replication protein O  
2559 2485986 2485687 300 - 32         Phage repressor  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|585397.7.peg.2551 Phage DNA binding protein Roi
MNELINSSIIKMTSIEIAELVGSRPDNVKISIERLAKSGVIQLPALQVFEKINNLGLRRS
VEAYVFEGEQGKRDSIIVVAQLSPEFTARLVDRWRELEETAVNIPKTLPEALRLAADLAE
QKMQLENQLAIAAPKVEFADRVGEASGILIGNYAKVVGIGPNKLFAWMRDHKILIASGAR
RNVPMQEYMERGYFTVKETAVNTNHGIQISFTTKITGRGQQWLTRKLLDNGMLKVTGEAA

MD5 = e845c67b6cbb8ec596c5bad452279a92


  DNA Sequence

>fig|585397.7.peg.2551 Phage DNA binding protein Roi
atgaatgagctgataaatagcagcatcatcaaaatgaccagcattgaaatcgctgagttg
gtggggagtcgtccagataacgtaaaaatatcaatagagcgcctggctaaatctggagtt
attcaacttcctgcattgcaggttttcgaaaaaatcaataacttaggactgcgccgtagt
gtcgaggcttacgtcttcgaaggcgaacaaggtaagcgagacagcattattgtcgtcgcc
caattgtcgccggaattcaccgctcgtcttgttgaccgttggcgagagcttgaagaaact
gcggttaatatccccaaaacgctaccagaagcgttgcgccttgctgctgatcttgctgag
cagaaaatgcaactggaaaaccagctcgcaattgccgcacctaaagttgagtttgccgat
cgagttggcgaggccagcggaattttgattggaaactatgcaaaggttgttggaattggt
ccaaacaaactgtttgcgtggatgcgcgatcacaaaatccttattgcttcaggtgcccgg
cgcaatgtgccaatgcaggaatatatggagcgcggctatttcacagtgaaagaaacagcg
gtcaacacaaatcacggaatacagatatcgttcaccacaaaaatcaccgggcgtggtcaa
cagtggctgaccagaaagctgctcgataacggaatgctgaaagtaacaggggaggctgct
taa


  DNA with Flanking Sequence

>fig|585397.7.peg.2551 Phage DNA binding protein Roi
tggacagaacgaggcgcagcccgtcacgcaaaaatgctcgaaactgatcaggcgtgggaa
gtgttcgaaaaactggaagactgctatttcagccagtgcgagaaaaatactggcaaacaa
gagaagaagctcaacggactttccgcaaaagaagcaaacagccttgtatggctatgggat
tatgccaaccgctcacaggcattgttccgtgagttgtatcccgcattaaaactgattcag
tctggctattccggcatatgccacgactacggctatgagttctcgtataccatcgggagg
gcgaggggcgttttaattaatcacacgcgggatatagatatttatgagcctgacgggccg
acgaaccttctggcatgggaaaggcttaagaacaaagagttgccgccttcactgcatcgc
tactgacaattgacaacttaacaaacccagcttcggctgggttttttattgctgaatttt
caatatgagaggacatgacaatgaatgagctgataaatagcagcatcatcaaaatgacca
gcattgaaatcgctgagttggtggggagtcgtccagataacgtaaaaatatcaatagagc
gcctggctaaatctggagttattcaacttcctgcattgcaggttttcgaaaaaatcaata
acttaggactgcgccgtagtgtcgaggcttacgtcttcgaaggcgaacaaggtaagcgag
acagcattattgtcgtcgcccaattgtcgccggaattcaccgctcgtcttgttgaccgtt
ggcgagagcttgaagaaactgcggttaatatccccaaaacgctaccagaagcgttgcgcc
ttgctgctgatcttgctgagcagaaaatgcaactggaaaaccagctcgcaattgccgcac
ctaaagttgagtttgccgatcgagttggcgaggccagcggaattttgattggaaactatg
caaaggttgttggaattggtccaaacaaactgtttgcgtggatgcgcgatcacaaaatcc
ttattgcttcaggtgcccggcgcaatgtgccaatgcaggaatatatggagcgcggctatt
tcacagtgaaagaaacagcggtcaacacaaatcacggaatacagatatcgttcaccacaa
aaatcaccgggcgtggtcaacagtggctgaccagaaagctgctcgataacggaatgctga
aagtaacaggggaggctgcttaatggctaaaccagcgcgaaggaaatgcaaaatatgcaa
agaatggtttcacccggcattctcaaatcagtggtggtgctgcccggaacacggaactca
attagcactcgaacgacgaagtaaagaacgcgaaaaagcggaaaaagcagcagagaagaa
acgacgacgagaggagcagaaacagaaagataaactgaagattcgaaaactcgccttaaa
gccccgcagttactggattaaacaagcccaacaagccgtaaacgccttcatcagagaaag
agaccgcgacttaccatgtatctcgtgcggaacgctcacgtctgctcagtgggatgccgg
acattaccggacaactgctgcggcacctcaactccgatttgatgaacgcaatattcacaa
gcaatgcgtggtgtgcaaccagcacaaaagcggaaatctcgttccgtatcgcgtcgaact
gattagccgcatcgggcaggaagcagtagatgaaatcgaatca


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|585397.9.peg.2548 Escherichia coli ED1a FIG   Phage DNA binding protein Roi


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|585397.7.peg.2550 Protein NinG


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search