The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|585396.4.peg.5910: Escherichia coli O111:H- str. 11128

This feature in The SEED Viewer

NCBI Taxonomy Id: 585396

Current Assignment: C1.100
Translate Function Assignments



Context on contig NC_013370 from base 90630 to 97179 (6550 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
5905 90630 91823 1194 +           Terminase A protein (PACase A protein) (DNA packaging A protein) locus|ECO111_p2-116, protein_id|YP_003238018.1, gi|260871238, geneID|8489931
5906 91823 93307 1485 + -1         Phage terminase, large subunit locus|ECO111_p2-117, protein_id|YP_003238019.1, gi|260871239, geneID|8489932
5907 94800 93913 888 - 605         Mobile element protein locus|ECO111_p2-119, protein_id|YP_003238021.1, gi|260871241, geneID|8489934
5908 95126 94800 327 - -1         Insertion element IS401 (Burkholderia multivorans) transposase locus|ECO111_p2-120, protein_id|YP_003238022.1, gi|260871242, geneID|8489935
5909 95426 96295 870 + 299         putative antirepressor protein locus|ECO111_p2-121, protein_id|YP_003238023.1, gi|260871243, geneID|8489936
5910 97179 96328 852 - 32         C1.100 locus|ECO111_p2-122, protein_id|YP_003238024.1, gi|260871244, geneID|8489937

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|585396.4.peg.5910 C1.100
MINYVYGEQLYQEFVSFRDLFLKKAVARAQHVDAASDGRPVRPVVVLPFKETDSIQAEID
KWTLMARELEQYPDLNIPKTILYPVPNILRGVRKVTTYQTEAVNSVNMTAGRIIHLIDKD
IRIQKSAGINEHSAKYIENLEATKELMKQYPEDEKFRMRVHGFSETMLRVHYISSSPNYN
DGKSVSYHVPLCGVFICDETLRDGIIINGEFEKAKFSLYDSIEPIICDRWPQAKIYRLAD
IENVKKQIAITREEKKVKSAASVARSRKTKKGQPVNDNPESAQ

MD5 = 22100816649b189243e346920eb70367


  DNA Sequence

>fig|585396.4.peg.5910 C1.100
atgataaattatgtctacggcgaacaactgtaccaggagttcgtcagcttcagggatctc
tttctaaaaaaagctgttgcacgcgcccaacacgttgatgccgccagcgacggtcgtcct
gtacgcccggttgtcgttctgccgttcaaagaaacggacagcattcaggctgaaattgat
aaatggactttaatggcgcgggaactggaacagtacccagacctcaatatcccaaagact
attttatatccagtgcctaacatccttcgcggtgtgcgtaaggttacaacttatcagaca
gaagctgtgaacagcgtcaacatgaccgctggccgcattattcatctgattgataaggac
attcgcatccagaaaagcgcggggatcaatgagcacagtgcgaaatacatagagaacctg
gaagcaacaaaagagctaatgaagcagtacccggaggatgaaaaattccgtatgcgtgta
cacggctttagcgaaacaatgctgcgcgtccattacatttccagtagccctaactacaat
gatggtaaatcagttagttaccatgtgccgctgtgtggtgtgtttatctgcgatgaaact
ctccgtgatggaatcatcatcaacggtgaattcgagaaagcaaaatttagcctttatgac
tctatagaaccgatcatctgcgaccgctggccgcaggcaaaaatatatcgcctggcagat
attgaaaatgtaaaaaaacaaattgccatcactcgcgaagagaaaaaggttaagtcagcc
gcatcagttgcgcgcagccgtaaaaccaagaaggggcagccagtaaacgacaaccccgaa
agcgcgcaataa


  DNA with Flanking Sequence

>fig|585396.4.peg.5910 C1.100
gttgtagagcggctcagaaggaaatgagcaaacagggaaaccttatacaacggcattaca
gctatgcattgctcatcttacacacagcgcaatgttgttagattaccccagcatggatca
tgggtgaaacagtaggtcagagcttcaggctctgtgttgtcaatacagtgaggcataatt
atggctttcattcaaccaaccatcgacgacgttagacattgctctaacgctttatctgta
gaccctgccgaaaccgacgctgcccgcgccattgctgaacactactcaaagatatccaat
caggagtaccgcatcacccaagacgacctggatgatctcactgacacaatcgaatatctc
atggccactaaccagccagactcacaataaatgcactaataaatctattattttcgttgg
atccttctataatggtggccaacaactcccagtgtaatccgctgtgagttgttggccatg
tcaattctggaggaggatcaatgataaattatgtctacggcgaacaactgtaccaggagt
tcgtcagcttcagggatctctttctaaaaaaagctgttgcacgcgcccaacacgttgatg
ccgccagcgacggtcgtcctgtacgcccggttgtcgttctgccgttcaaagaaacggaca
gcattcaggctgaaattgataaatggactttaatggcgcgggaactggaacagtacccag
acctcaatatcccaaagactattttatatccagtgcctaacatccttcgcggtgtgcgta
aggttacaacttatcagacagaagctgtgaacagcgtcaacatgaccgctggccgcatta
ttcatctgattgataaggacattcgcatccagaaaagcgcggggatcaatgagcacagtg
cgaaatacatagagaacctggaagcaacaaaagagctaatgaagcagtacccggaggatg
aaaaattccgtatgcgtgtacacggctttagcgaaacaatgctgcgcgtccattacattt
ccagtagccctaactacaatgatggtaaatcagttagttaccatgtgccgctgtgtggtg
tgtttatctgcgatgaaactctccgtgatggaatcatcatcaacggtgaattcgagaaag
caaaatttagcctttatgactctatagaaccgatcatctgcgaccgctggccgcaggcaa
aaatatatcgcctggcagatattgaaaatgtaaaaaaacaaattgccatcactcgcgaag
agaaaaaggttaagtcagccgcatcagttgcgcgcagccgtaaaaccaagaaggggcagc
cagtaaacgacaaccccgaaagcgcgcaataaattatgcccggcatcaaccgggcattct
tccattattcagccgccaccggttttaacaagccagcatcgagcagtttacgcgtcaacc
actgctggcctttacccgttaattgaggcgtcaaccgtatctggtagccatcttcatcat
ccagcaccacttctttcaccgtgaaataccccgcgttgatgtactgctggaacggcacat
ttttacgtccaccggacgctatcaggatgccgttctcccgtaaccagacaaacagcgcgt
tttgcttaagtccaacaacctttgcaaaattcccaatcaggatccctttagctactgata
cccggtcggcaaaatcgactttaggagcggcggccaccagctgctgatttagctggtggg
ctttctgttccagaagttgcttttgttcagccagttcggcagccaggcgtaggacttcag
gaagcgtctgggggattgcgatcggttgctgttctttttgtcggaagtagct


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
dbj|BAI39316.1 Escherichia coli O111:H- str. 11128     primary repressor of lytic functions
gi|257767823 Escherichia coli O111:H- str. 11128 NCBI   primary repressor of lytic functions


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search