The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|585396.4.peg.5909: Escherichia coli O111:H- str. 11128

This feature in The SEED Viewer

NCBI Taxonomy Id: 585396

Current Assignment: putative antirepressor protein
Translate Function Assignments



Context on contig NC_013370 from base 90170 to 97179 (7010 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
5904 90170 90544 375 +           Late promoter-activating protein (Gp10) locus|ECO111_p2-115, protein_id|YP_003238017.1, gi|260871237, geneID|8489930
5905 90630 91823 1194 + 85         Terminase A protein (PACase A protein) (DNA packaging A protein) locus|ECO111_p2-116, protein_id|YP_003238018.1, gi|260871238, geneID|8489931
5906 91823 93307 1485 + -1         Phage terminase, large subunit locus|ECO111_p2-117, protein_id|YP_003238019.1, gi|260871239, geneID|8489932
5907 94800 93913 888 - 605         Mobile element protein locus|ECO111_p2-119, protein_id|YP_003238021.1, gi|260871241, geneID|8489934
5908 95126 94800 327 - -1         Insertion element IS401 (Burkholderia multivorans) transposase locus|ECO111_p2-120, protein_id|YP_003238022.1, gi|260871242, geneID|8489935
5909 95426 96295 870 + 299         putative antirepressor protein locus|ECO111_p2-121, protein_id|YP_003238023.1, gi|260871243, geneID|8489936
5910 97179 96328 852 - 32         C1.100 locus|ECO111_p2-122, protein_id|YP_003238024.1, gi|260871244, geneID|8489937

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|585396.4.peg.5909 putative antirepressor protein
MKANNVKLEKIHAPSVQESELVVVQNQSDEIPVLEWQGVRVVTTETLARGYGTETIRIRQ
NHHENKVRFVEGKHFFKVEGESLRELKHRVALNYSVKIARNVRSLTLWTERGAARHAKML
ETDQAWAFFEKLEDSYFRQKEQQPIAIPQTLPEVLRLAAELAEQKQLLEQKAHQLNQQLV
AAAPKVDFADRVSVAKGILIGNFAKVVGLKQNALFVWLRENGILIASGGRKNVPFQQYIN
AGYFTVKEVVLDDEDGYQIRLTPQLTGKGQQWLTRKLLDAGLLKPVAAE

MD5 = 1ace9a643e896212fbde374bc19ff1c9


  DNA Sequence

>fig|585396.4.peg.5909 putative antirepressor protein
atgaaagcaaataacgttaaattagaaaaaattcatgcaccttcagttcaggaatcggag
ctggtggttgttcagaatcagtctgatgaaattcccgttctggaatggcagggagtgcgt
gtagtgacaaccgagactcttgcgagagggtatgggacagaaacaatccgtattcgccaa
aatcatcatgagaacaaagtacgctttgttgaagggaagcactttttcaaagttgaagga
gaatcattgcgcgagttgaagcacagagtagctttaaactactctgtaaaaattgctcgc
aatgttcgctcactcaccctctggacagaacgcggcgcagcccgccacgctaaaatgctc
gaaaccgatcaggcatgggcattctttgaaaaactggaagacagctacttccgacaaaaa
gaacagcaaccgatcgcaatcccccagacgcttcctgaagtcctacgcctggctgccgaa
ctggctgaacaaaagcaacttctggaacagaaagcccaccagctaaatcagcagctggtg
gccgccgctcctaaagtcgattttgccgaccgggtatcagtagctaaagggatcctgatt
gggaattttgcaaaggttgttggacttaagcaaaacgcgctgtttgtctggttacgggag
aacggcatcctgatagcgtccggtggacgtaaaaatgtgccgttccagcagtacatcaac
gcggggtatttcacggtgaaagaagtggtgctggatgatgaagatggctaccagatacgg
ttgacgcctcaattaacgggtaaaggccagcagtggttgacgcgtaaactgctcgatgct
ggcttgttaaaaccggtggcggctgaataa


  DNA with Flanking Sequence

>fig|585396.4.peg.5909 putative antirepressor protein
gctggtgagcccaccatcaccgcccccggtatcccgctcatgctggcgaacccagacacg
cagagtctccggcgtacagccaatctttggggcaatggaacaaattgccgcccactgtga
gtcatattcatcctgactttccagaaccatacgaatcgcccgctgacggacttcggggga
aaaacgagtatttttagtcatcctgtttacctctttctcagggagtttagtctccaggat
ttccggggcggttcagaacgtcattagtcacccgtgaagagatgatcgaggcaattgaac
agcacacaatctgtatcagcaccagggatatacctggcgttattgccaactacttcatga
tcaccaaacaactttaccggagaaaggacaagaacgcggttcaccgtatcctgttgtctg
atatccgcgaatacctgctcgaacagggtcatctgaattacgcaaccgtcgcagccgaag
cacgcaaggaggcacacagaatgaaagcaaataacgttaaattagaaaaaattcatgcac
cttcagttcaggaatcggagctggtggttgttcagaatcagtctgatgaaattcccgttc
tggaatggcagggagtgcgtgtagtgacaaccgagactcttgcgagagggtatgggacag
aaacaatccgtattcgccaaaatcatcatgagaacaaagtacgctttgttgaagggaagc
actttttcaaagttgaaggagaatcattgcgcgagttgaagcacagagtagctttaaact
actctgtaaaaattgctcgcaatgttcgctcactcaccctctggacagaacgcggcgcag
cccgccacgctaaaatgctcgaaaccgatcaggcatgggcattctttgaaaaactggaag
acagctacttccgacaaaaagaacagcaaccgatcgcaatcccccagacgcttcctgaag
tcctacgcctggctgccgaactggctgaacaaaagcaacttctggaacagaaagcccacc
agctaaatcagcagctggtggccgccgctcctaaagtcgattttgccgaccgggtatcag
tagctaaagggatcctgattgggaattttgcaaaggttgttggacttaagcaaaacgcgc
tgtttgtctggttacgggagaacggcatcctgatagcgtccggtggacgtaaaaatgtgc
cgttccagcagtacatcaacgcggggtatttcacggtgaaagaagtggtgctggatgatg
aagatggctaccagatacggttgacgcctcaattaacgggtaaaggccagcagtggttga
cgcgtaaactgctcgatgctggcttgttaaaaccggtggcggctgaataatggaagaatg
cccggttgatgccgggcataatttattgcgcgctttcggggttgtcgtttactggctgcc
ccttcttggttttacggctgcgcgcaactgatgcggctgacttaacctttttctcttcgc
gagtgatggcaatttgtttttttacattttcaatatctgccaggcgatatatttttgcct
gcggccagcggtcgcagatgatcggttctatagagtcataaaggctaaattttgctttct
cgaattcaccgttgatgatgattccatcacggagagtttcatcgcagataaacacaccac
acagcggcacatggtaactaactgatttaccatcattgtagttagggctactggaaatgt
aatggacgcgcagcattgtttcgctaaagccgtgtacacgcatacggaatttttcatcct
ccgggtactgcttcattagctcttttgttgcttccaggttctctatgtatttcgcactgt
gctcattgat


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


Tool Description
General Tools
Psi-Blast NCBI's psi-blast is used to locate distant similarities
Transmembrane Predictions
TMpred Tool for Predicting Transmembrane regions
TMHMM Prediction of transmembrane helices in proteins
Protein Signals for Gram negative bacteria
Gram negative PSORT Prediction of protein localization sites
Gram negative SignalP Predicts the presence and location of signal peptide cleavage sites
Protein Signals for Gram positive bacteria
Gram positive PSORT Prediction of protein localization sites
Gram positive SignalP Predicts the presence and location of signal peptide cleavage sites
Other useful tools
LipoP Prediction of lipoproteins and signal peptides in Gram negative bacteria
Radar Rapid Automatic Detection and Alignment of Repeats in protein sequences
PPSearch Search for protein motifs against all patterns stored in the PROSITE pattern database
Gram negative CELLO Subcellular localization predictor at National Chiao Tung University
Gram positive CELLO Subcellular localization predictor at National Chiao Tung University
ProDom A comprehensive set of protein domain families automatically generated from the SWISS-PROT and TrEMBL sequence databases
PDB An Information Portal to Biological Macromolecular Structures
For Specific Organisms
RNAFold The RNAfold web server will predict secondary structures of single stranded RNA or DNA sequences.

< Hide tool descriptions


FIG search