The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|585396.4.peg.5908: Escherichia coli O111:H- str. 11128

This feature in The SEED Viewer

NCBI Taxonomy Id: 585396

Current Assignment: Insertion element IS401 (Burkholderia multivorans) transposase
Translate Function Assignments



Context on contig NC_013370 from base 88960 to 97179 (8220 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
5903 88960 90003 1044 +           Putative cytoplasmic protein locus|ECO111_p2-114, protein_id|YP_003238016.1, gi|260871236, geneID|8489929
5904 90170 90544 375 + 166         Late promoter-activating protein (Gp10) locus|ECO111_p2-115, protein_id|YP_003238017.1, gi|260871237, geneID|8489930
5905 90630 91823 1194 + 85         Terminase A protein (PACase A protein) (DNA packaging A protein) locus|ECO111_p2-116, protein_id|YP_003238018.1, gi|260871238, geneID|8489931
5906 91823 93307 1485 + -1         Phage terminase, large subunit locus|ECO111_p2-117, protein_id|YP_003238019.1, gi|260871239, geneID|8489932
5907 94800 93913 888 - 605 8     Mobile element protein locus|ECO111_p2-119, protein_id|YP_003238021.1, gi|260871241, geneID|8489934
5908 95126 94800 327 - -1       Insertion element IS401 (Burkholderia multivorans) transposase locus|ECO111_p2-120, protein_id|YP_003238022.1, gi|260871242, geneID|8489935
5909 95426 96295 870 + 299         putative antirepressor protein locus|ECO111_p2-121, protein_id|YP_003238023.1, gi|260871243, geneID|8489936
5910 97179 96328 852 - 32         C1.100 locus|ECO111_p2-122, protein_id|YP_003238024.1, gi|260871244, geneID|8489937

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|585396.4.peg.5908 Insertion element IS401 (Burkholderia multivorans) transposase
MTKNTRFSPEVRQRAIRMVLESQDEYDSQWAAICSIAPKIGCTPETLRVWVRQHERDTGG
GDGGLTSAERQRLKELERENRELRRSNDILRQASAYFAKAEFDRLWKK

MD5 = e23dc931776e1e3d8fa96a9d473dee69


  DNA Sequence

>fig|585396.4.peg.5908 Insertion element IS401 (Burkholderia multivorans) transposase
atgactaaaaatactcgtttttcccccgaagtccgtcagcgggcgattcgtatggttctg
gaaagtcaggatgaatatgactcacagtgggcggcaatttgttccattgccccaaagatt
ggctgtacgccggagactctgcgtgtctgggttcgccagcatgagcgggataccgggggc
ggtgatggtgggctcaccagcgctgaacgtcagcgtctgaaagagctggaacgtgaaaat
cgtgaactgcgccgcagtaacgatatccttcgccaggcttccgcttattttgcgaaggcg
gagttcgaccgcctctggaaaaaatga


  DNA with Flanking Sequence

>fig|585396.4.peg.5908 Insertion element IS401 (Burkholderia multivorans) transposase
tactttgttctcatgatgattttggcgaatacggattgtttctgtcccataccctctcgc
aagagtctcggttgtcactacacgcactccctgccattccagaacgggaatttcatcaga
ctgattctgaacaaccaccagctccgattcctgaactgaaggtgcatgaattttttctaa
tttaacgttatttgctttcattctgtgtgcctccttgcgtgcttcggctgcgacggttgc
gtaattcagatgaccctgttcgagcaggtattcgcggatatcagacaacaggatacggtg
aaccgcgttcttgtcctttctccggtaaagttgtttggtgatcatgaagtagttggcaat
aacgccaggtatatccctggtgctgatacagattgtgtgctgttcaattgcctcgatcat
ctcttcacgggtgactaatgacgttctgaaccgccccggaaatcctggagactaaactcc
ctgagaaagaggtaaacaggatgactaaaaatactcgtttttcccccgaagtccgtcagc
gggcgattcgtatggttctggaaagtcaggatgaatatgactcacagtgggcggcaattt
gttccattgccccaaagattggctgtacgccggagactctgcgtgtctgggttcgccagc
atgagcgggataccgggggcggtgatggtgggctcaccagcgctgaacgtcagcgtctga
aagagctggaacgtgaaaatcgtgaactgcgccgcagtaacgatatccttcgccaggctt
ccgcttattttgcgaaggcggagttcgaccgcctctggaaaaaatgatgccactgctgga
taagctgcgtgagcagtacggggtcggaccggtatgcagcgaactgcatattgccccgtc
aacgtattaccattgtcagcaacagcgacatcatccggataaacgcagtgcccgtgcgca
gcacgacgactggctgaagagagagatacagcgcgtatacgatgaaaatcatcaggtgta
cggtgtgcgtaaagtctggcgtcagttgttacgggaaggaatcagggtggccagatgtac
agtggcacgtctcatggcggttatgggacttgccggtgttctccggggtaaaaaggtccg
tacgaccatcagccggaaagccgttgccgcaggcgaccgcgtaaaccgtcagttcgtggc
agaacgacctgaccagctgtgggtggctgattttacttacgtcagcacatggcagggctt
cgtctatgtggcgtttatcattgatgtgtttgccggatacatcgtggggtggcgggtctc
atcgtct


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
GO:0004803       F:transposase activity
GO:0006313       P:transposition, DNA-mediated
cmr|NT02EC1846 Escherichia coli O157:H7 EDL933     unknown protein in IS629
cmr|NT02EC2013 Escherichia coli O157:H7 EDL933     unknown protein in IS629
cmr|NT02EC2264 Escherichia coli O157:H7 EDL933     unknown protein in IS629
cmr|NT02EC2312 Escherichia coli O157:H7 EDL933     unknown protein in IS629
cmr|NT02EC2970 Escherichia coli O157:H7 EDL933     unknown protein in IS629
cmr|NT02EC3162 Escherichia coli O157:H7 EDL933     unknown protein in IS629
cmr|NT02EC3739 Escherichia coli O157:H7 EDL933     unknown protein in IS629
cmr|NT02EC4123 Escherichia coli O157:H7 EDL933     unknown protein in IS629
cmr|NT02EC4293 Escherichia coli O157:H7 EDL933     unknown protein in IS629
cmr|NT02EC5554 Escherichia coli O157:H7 EDL933     unknown protein in IS629
cmr|NT03EC1336 Escherichia coli O157:H7 VT2-Sakai     Transposase subfamily
cmr|NT03EC1467 Escherichia coli O157:H7 VT2-Sakai     Transposase subfamily
cmr|NT03EC2002 Escherichia coli O157:H7 VT2-Sakai     Transposase subfamily
cmr|NT03EC2316 Escherichia coli O157:H7 VT2-Sakai     Transposase subfamily
cmr|NT03EC2693 Escherichia coli O157:H7 VT2-Sakai     Transposase subfamily
cmr|NT03EC3330 Escherichia coli O157:H7 VT2-Sakai     Transposase subfamily
cmr|NT03EC3797 Escherichia coli O157:H7 VT2-Sakai     Transposase subfamily
cmr|NT03EC4240 Escherichia coli O157:H7 VT2-Sakai     Transposase subfamily
cmr|NT03EC4707 Escherichia coli O157:H7 VT2-Sakai     Transposase subfamily
cmr|NT03EC4903 Escherichia coli O157:H7 VT2-Sakai     Transposase subfamily
cmr|NT03EC6440 Escherichia coli O157:H7 VT2-Sakai     Transposase subfamily
dbj|BAA31788.1 Escherichia coli O157:H7 str. Sakai     IS629
dbj|BAA33757.1 Escherichia coli     unnamed protein product
dbj|BAA94145.1 Enterobacteria phage VT2-Sakai     hypothetical 12kD protein
dbj|BAB34512.1 Escherichia coli O157:H7 str. Sakai     putative transposase OrfA protein of insertion sequence IS629
dbj|BAB34632.1 Escherichia coli O157:H7 str. Sakai     putative transposase OrfA protein of insertion sequence IS629
dbj|BAB35088.1 Escherichia coli O157:H7 str. Sakai     putative transposase OrfA protein of insertion sequence IS629
dbj|BAB35342.1 Escherichia coli O157:H7 str. Sakai     putative transposase OrfA protein of insertion sequence IS629
dbj|BAB35643.1 Escherichia coli O157:H7 str. Sakai     putative transposase OrfA protein of insertion sequence IS629
dbj|BAB36167.1 Escherichia coli O157:H7 str. Sakai     putative transposase OrfA protein of insertion sequence IS629
dbj|BAB36555.1 Escherichia coli O157:H7 str. Sakai     putative transposase OrfA protein of insertion sequence IS629
dbj|BAB36913.1 Escherichia coli O157:H7 str. Sakai     putative transposase OrfA protein of insertion sequence IS629
dbj|BAB37286.1 Escherichia coli O157:H7 str. Sakai     putative transposase OrfA protein of insertion sequence IS629
dbj|BAB37447.1 Escherichia coli O157:H7 str. Sakai     putative transposase OrfA protein of insertion sequence IS629
dbj|BAB38666.1 Escherichia coli O157:H7 str. Sakai     putative transposase OrfA protein of insertion sequence IS629
dbj|BAB60675.1 Escherichia coli     ORFa
dbj|BAC78135.1 Stx2 converting phage II     hypothetical protein
dbj|BAI23934.1 Escherichia coli O26:H11 str. 11368     putative IS629 transposase OrfA
dbj|BAI24174.1 Escherichia coli O26:H11 str. 11368     putative IS629 transposase OrfA
dbj|BAI24433.1 Escherichia coli O26:H11 str. 11368     putative IS629 transposase OrfA
dbj|BAI27257.1 Escherichia coli O26:H11 str. 11368     putative IS629 transposase OrfA
dbj|BAI27547.1 Escherichia coli O26:H11 str. 11368     putative IS629 transposase OrfA
dbj|BAI34295.1 Escherichia coli O111:H- str. 11128     putative IS629 transposase OrfA
dbj|BAI34304.1 Escherichia coli O111:H- str. 11128     putative IS629 transposase OrfA
dbj|BAI34555.1 Escherichia coli O111:H- str. 11128     putative IS629 transposase OrfA
dbj|BAI34749.1 Escherichia coli O111:H- str. 11128     putative IS629 transposase OrfA
dbj|BAI34995.1 Escherichia coli O111:H- str. 11128     putative IS629 transposase OrfA
dbj|BAI35030.1 Escherichia coli O111:H- str. 11128     putative IS629 transposase OrfA
dbj|BAI35165.1 Escherichia coli O111:H- str. 11128     putative IS629 transposase OrfA
dbj|BAI35237.1 Escherichia coli O111:H- str. 11128     putative IS629 transposase OrfA
dbj|BAI35360.1 Escherichia coli O111:H- str. 11128     putative IS629 transposase OrfA
dbj|BAI35507.1 Escherichia coli O111:H- str. 11128     putative IS629 transposase OrfA
dbj|BAI35528.1 Escherichia coli O111:H- str. 11128     putative IS629 transposase OrfA
dbj|BAI35648.1 Escherichia coli O111:H- str. 11128     putative IS629 transposase OrfA
dbj|BAI35844.1 Escherichia coli O111:H- str. 11128     putative IS629 transposase OrfA
dbj|BAI36056.1 Escherichia coli O111:H- str. 11128     putative IS629 transposase OrfA
dbj|BAI36163.1 Escherichia coli O111:H- str. 11128     putative IS629 transposase OrfA
dbj|BAI36480.1 Escherichia coli O111:H- str. 11128     putative IS629 transposase OrfA
dbj|BAI36484.1 Escherichia coli O111:H- str. 11128     putative IS629 transposase OrfA
dbj|BAI36496.1 Escherichia coli O111:H- str. 11128     putative IS629 transposase OrfA
dbj|BAI36511.1 Escherichia coli O111:H- str. 11128     putative IS629 transposase OrfA
dbj|BAI36529.1 Escherichia coli O111:H- str. 11128     putative IS629 transposase OrfA
dbj|BAI36531.1 Escherichia coli O111:H- str. 11128     putative IS629 transposase OrfA
dbj|BAI37166.1 Escherichia coli O111:H- str. 11128     putative IS629 transposase OrfA
dbj|BAI37185.1 Escherichia coli O111:H- str. 11128     putative IS629 transposase OrfA
dbj|BAI37509.1 Escherichia coli O111:H- str. 11128     putative IS629 transposase OrfA
dbj|BAI37559.1 Escherichia coli O111:H- str. 11128     putative IS629 transposase OrfA
dbj|BAI37776.1 Escherichia coli O111:H- str. 11128     putative IS629 transposase OrfA
dbj|BAI38081.1 Escherichia coli O111:H- str. 11128     putative IS629 transposase OrfA
dbj|BAI38263.1 Escherichia coli O111:H- str. 11128     putative IS629 transposase OrfA
dbj|BAI38733.1 Escherichia coli O111:H- str. 11128     putative IS629 transposase OrfA
dbj|BAI38813.1 Escherichia coli O111:H- str. 11128     putative IS629 transposase OrfA
dbj|BAI38890.1 Escherichia coli O111:H- str. 11128     putative IS629 transposase OrfA
dbj|BAI38915.1 Escherichia coli O111:H- str. 11128     putative IS629 transposase OrfA
dbj|BAI39001.1 Escherichia coli O111:H- str. 11128     putative IS629 transposase OrfA
dbj|BAI39011.1 Escherichia coli O111:H- str. 11128     putative IS629 transposase OrfA
dbj|BAI39122.1 Escherichia coli O111:H- str. 11128     putative IS629 transposase OrfA
dbj|BAI39283.1 Escherichia coli O111:H- str. 11128     putative IS629 transposase OrfA
dbj|BAI39314.1 Escherichia coli O111:H- str. 11128     putative IS629 transposase OrfA
dbj|BAI39343.1 Escherichia coli O111:H- str. 11128     putative IS629 transposase OrfA
dbj|BAI39376.1 Escherichia coli O111:H- str. 11128     putative IS629 transposase OrfA
emb|CAC79971.1 Escherichia coli EMBL   orf327
emb|CAC83131.1 Bacteriophage CP-1639 EMBL   putative transposase
emb|CAC83136.1 Bacteriophage CP-1639 EMBL   putative transposase
emb|CAD88878.1 Phage BP-4795 EMBL   putative transposase OrfA protein of IS629
emb|CAH23249.1 Bacteriophage CP-1639 EMBL   unnamed protein product
emb|CAI79563.1 Escherichia coli EMBL   insertion element IS629 protein
emb|CAJ77749.1 Escherichia coli EMBL   hypothetical protein
emb|CAX18548.1 Escherichia coli EMBL   putative transposase
emb|CAX18601.1 Escherichia coli EMBL   putative insertion sequence related protein
emb|CAX18695.1 Escherichia coli EMBL   putative transposase
emb|CAX18758.1 Escherichia coli EMBL   putative transposase
eric|ABH-0025721 Escherichia coli ASAP   unknown in IS629
eric|ABH-0025889 Escherichia coli ASAP   putative transposase encoded within prophage CP-933O
eric|ABH-0026141 Escherichia coli ASAP   orf hypothetical protein in IS629 within prophage CP-933R
eric|ABH-0026186 Escherichia coli ASAP   unknown protein in IS629
eric|ABH-0026824 Escherichia coli ASAP   unknown in IS629 encoded within prophage CP-933U
eric|ABH-0027026 Escherichia coli ASAP   unknown protein in IS629
eric|ABH-0027601 Escherichia coli ASAP   putative transposase
eric|ABH-0028009 Escherichia coli ASAP   unknown protein in IS629
eric|ABH-0028176 Escherichia coli ASAP   orf hypothetical protein in IS629
eric|ABH-0029452 Escherichia coli ASAP   orf hypothetical protein in IS
eric|ABH-0244121 Escherichia coli ASAP   hypothetical protein
eric|ACA-0131008 Escherichia coli ASAP   putative transposase OrfA protein of insertion sequence IS629
eric|ACA-0131135 Escherichia coli ASAP   putative transposase OrfA protein of insertion sequence IS629
eric|ACA-0131616 Escherichia coli ASAP   putative transposase OrfA protein of insertion sequence IS629
eric|ACA-0131884 Escherichia coli ASAP   putative transposase OrfA protein of insertion sequence IS629
eric|ACA-0132195 Escherichia coli ASAP   putative transposase OrfA protein of insertion sequence IS629
eric|ACA-0132736 Escherichia coli ASAP   putative transposase OrfA protein of insertion sequence IS629
eric|ACA-0133143 Escherichia coli ASAP   putative transposase OrfA protein of insertion sequence IS629
eric|ACA-0133516 Escherichia coli ASAP   putative transposase OrfA protein of insertion sequence IS629
eric|ACA-0133916 Escherichia coli ASAP   putative transposase OrfA protein of insertion sequence IS629
eric|ACA-0134086 Escherichia coli ASAP   putative transposase OrfA protein of insertion sequence IS629
eric|ACA-0135362 Escherichia coli ASAP   putative transposase OrfA protein of insertion sequence IS629
eric|ACA-0244220 Escherichia coli ASAP   predicted protein
eric|ADM-0002225 Escherichia coli ASAP   COG2963: Transposase and inactivated derivatives
eric|ADM-0003837 Escherichia coli ASAP   COG2963: Transposase and inactivated derivatives
eric|ADM-0004461 Escherichia coli ASAP   COG2963: Transposase and inactivated derivatives
eric|BAJ-0000224 Escherichia coli ASAP   insertion element IS629 protein
eric|BAS-0000379 Escherichia coli ASAP   hypothetical protein
eric|BAS-0000432 Escherichia coli ASAP   hypothetical protein
eric|BAS-0000488 Escherichia coli ASAP   hypothetical protein
eric|BAS-0001183 Escherichia coli ASAP   hypothetical protein
eric|BAS-0001188 Escherichia coli ASAP   hypothetical protein
eric|BAS-0001243 Escherichia coli ASAP   hypothetical protein
eric|BAS-0001372 Escherichia coli ASAP   hypothetical protein
eric|BAS-0001478 Escherichia coli ASAP   hypothetical protein
eric|BAS-0001737 Escherichia coli ASAP   hypothetical protein
eric|BAS-0002544 Escherichia coli ASAP   hypothetical protein
eric|BAS-0003655 Escherichia coli ASAP   hypothetical protein
eric|BAS-0003888 Escherichia coli ASAP   hypothetical protein
eric|BAS-0004300 Escherichia coli ASAP   hypothetical protein
eric|BAS-0004635 Escherichia coli ASAP   hypothetical protein
eric|BAT-0000128 Escherichia coli ASAP   hypothetical protein
eric|BAT-0000955 Escherichia coli ASAP   hypothetical protein
eric|BAT-0001021 Escherichia coli ASAP   hypothetical protein
eric|BAT-0001360 Escherichia coli ASAP   hypothetical protein
eric|BAT-0001596 Escherichia coli ASAP   hypothetical protein
eric|BAT-0001722 Escherichia coli ASAP   hypothetical protein
eric|BAT-0002321 Escherichia coli ASAP   hypothetical protein
eric|BAT-0002452 Escherichia coli ASAP   hypothetical protein
eric|BAT-0002529 Escherichia coli ASAP   hypothetical protein
eric|BAT-0002812 Escherichia coli ASAP   hypothetical protein
eric|BAT-0003060 Escherichia coli ASAP   hypothetical protein
eric|BAT-0003255 Escherichia coli ASAP   hypothetical protein
eric|BAT-0003510 Escherichia coli ASAP   hypothetical protein
eric|BAT-0003839 Escherichia coli ASAP   hypothetical protein
eric|BAU-0000121 Escherichia coli ASAP   hypothetical protein
eric|BAU-0000227 Escherichia coli ASAP   hypothetical protein
eric|BAU-0001239 Escherichia coli ASAP   hypothetical protein
eric|BAU-0001384 Escherichia coli ASAP   hypothetical protein
eric|BAU-0001544 Escherichia coli ASAP   hypothetical protein
eric|BAU-0002112 Escherichia coli ASAP   hypothetical protein
eric|BAU-0002162 Escherichia coli ASAP   hypothetical protein
eric|BAU-0003018 Escherichia coli ASAP   hypothetical protein
eric|BAU-0003294 Escherichia coli ASAP   hypothetical protein
eric|BAU-0003435 Escherichia coli ASAP   hypothetical protein
eric|BAU-0003722 Escherichia coli ASAP   hypothetical protein
eric|BAU-0003960 Escherichia coli ASAP   hypothetical protein
eric|BAU-0004755 Escherichia coli ASAP   hypothetical protein
eric|BAV-0000814 Escherichia coli ASAP   hypothetical protein
eric|BAV-0000941 Escherichia coli ASAP   hypothetical protein
eric|BAV-0001233 Escherichia coli ASAP   hypothetical protein
eric|BAV-0001376 Escherichia coli ASAP   hypothetical protein
eric|BAV-0001738 Escherichia coli ASAP   hypothetical protein
eric|BAV-0001916 Escherichia coli ASAP   hypothetical protein
eric|BAV-0002023 Escherichia coli ASAP   hypothetical protein
eric|BAV-0002175 Escherichia coli ASAP   hypothetical protein
eric|BAV-0002235 Escherichia coli ASAP   hypothetical protein
eric|BAV-0003321 Escherichia coli ASAP   hypothetical protein
eric|BAV-0003590 Escherichia coli ASAP   hypothetical protein
eric|BAV-0003797 Escherichia coli ASAP   hypothetical protein
eric|BAV-0004210 Escherichia coli ASAP   hypothetical protein
eric|BAW-0000236 Escherichia coli ASAP   hypothetical protein
eric|BAW-0000279 Escherichia coli ASAP   hypothetical protein
eric|BAW-0000530 Escherichia coli ASAP   hypothetical protein
eric|BAW-0000554 Escherichia coli ASAP   hypothetical protein
eric|BAW-0000822 Escherichia coli ASAP   hypothetical protein
eric|BAW-0000927 Escherichia coli ASAP   hypothetical protein
eric|BAW-0001347 Escherichia coli ASAP   hypothetical protein
eric|BAW-0001813 Escherichia coli ASAP   hypothetical protein
eric|BAW-0001951 Escherichia coli ASAP   hypothetical protein
eric|BAW-0002059 Escherichia coli ASAP   hypothetical protein
eric|BAW-0002326 Escherichia coli ASAP   hypothetical protein
eric|BAW-0002460 Escherichia coli ASAP   hypothetical protein
eric|BAW-0002947 Escherichia coli ASAP   hypothetical protein
eric|BAW-0002954 Escherichia coli ASAP   hypothetical protein
eric|BAW-0003810 Escherichia coli ASAP   hypothetical protein
eric|BAX-0000081 Escherichia coli ASAP   hypothetical protein
eric|BAX-0000276 Escherichia coli ASAP   hypothetical protein
eric|BAX-0000678 Escherichia coli ASAP   hypothetical protein
eric|BAX-0000874 Escherichia coli ASAP   hypothetical protein
eric|BAX-0000900 Escherichia coli ASAP   hypothetical protein
eric|BAX-0002011 Escherichia coli ASAP   hypothetical protein
eric|BAX-0002199 Escherichia coli ASAP   hypothetical protein
eric|BAX-0002305 Escherichia coli ASAP   hypothetical protein
eric|BAX-0002497 Escherichia coli ASAP   hypothetical protein
eric|BAX-0002530 Escherichia coli ASAP   hypothetical protein
eric|BAX-0002636 Escherichia coli ASAP   hypothetical protein
eric|BAX-0002902 Escherichia coli ASAP   hypothetical protein
eric|BAX-0003339 Escherichia coli ASAP   hypothetical protein
eric|BAX-0003586 Escherichia coli ASAP   hypothetical protein
eric|BAX-0003597 Escherichia coli ASAP   hypothetical protein
eric|BAX-0003759 Escherichia coli ASAP   hypothetical protein
eric|BAY-0000205 Escherichia coli ASAP   hypothetical protein
eric|BAY-0000232 Escherichia coli ASAP   hypothetical protein
eric|BAY-0000364 Escherichia coli ASAP   hypothetical protein
eric|BAY-0000801 Escherichia coli ASAP   hypothetical protein
eric|BAY-0001101 Escherichia coli ASAP   hypothetical protein
eric|BAY-0001396 Escherichia coli ASAP   hypothetical protein
eric|BAY-0001419 Escherichia coli ASAP   hypothetical protein
eric|BAY-0001456 Escherichia coli ASAP   hypothetical protein
eric|BAY-0001521 Escherichia coli ASAP   hypothetical protein
eric|BAY-0002469 Escherichia coli ASAP   hypothetical protein
eric|BAY-0002722 Escherichia coli ASAP   hypothetical protein
eric|BAY-0003594 Escherichia coli ASAP   hypothetical protein
eric|BAY-0003841 Escherichia coli ASAP   hypothetical protein
eric|BAY-0004108 Escherichia coli ASAP   hypothetical protein
eric|BAY-0004652 Escherichia coli ASAP   hypothetical protein
eric|BAZ-0000280 Escherichia coli ASAP   hypothetical protein
eric|BAZ-0000662 Escherichia coli ASAP   hypothetical protein
eric|BAZ-0000931 Escherichia coli ASAP   hypothetical protein
eric|BAZ-0000990 Escherichia coli ASAP   hypothetical protein
eric|BAZ-0001373 Escherichia coli ASAP   hypothetical protein
eric|BAZ-0001495 Escherichia coli ASAP   hypothetical protein
eric|BAZ-0001579 Escherichia coli ASAP   hypothetical protein
eric|BAZ-0002394 Escherichia coli ASAP   hypothetical protein
eric|BAZ-0003167 Escherichia coli ASAP   hypothetical protein
eric|BAZ-0003510 Escherichia coli ASAP   hypothetical protein
eric|BAZ-0003594 Escherichia coli ASAP   hypothetical protein
eric|BAZ-0003623 Escherichia coli ASAP   hypothetical protein
eric|BAZ-0004528 Escherichia coli ASAP   hypothetical protein
eric|BAZ-0004635 Escherichia coli ASAP   hypothetical protein
eric|BBA-0000720 Escherichia coli ASAP   hypothetical protein
eric|BBA-0000838 Escherichia coli ASAP   hypothetical protein
eric|BBA-0001026 Escherichia coli ASAP   hypothetical protein
eric|BBA-0001159 Escherichia coli ASAP   hypothetical protein
eric|BBA-0001480 Escherichia coli ASAP   hypothetical protein
eric|BBA-0001803 Escherichia coli ASAP   hypothetical protein
eric|BBA-0001892 Escherichia coli ASAP   hypothetical protein
eric|BBA-0001913 Escherichia coli ASAP   hypothetical protein
eric|BBA-0002173 Escherichia coli ASAP   hypothetical protein
eric|BBA-0003001 Escherichia coli ASAP   hypothetical protein
eric|BBA-0003431 Escherichia coli ASAP   hypothetical protein
eric|BBA-0003502 Escherichia coli ASAP   hypothetical protein
eric|BBA-0003549 Escherichia coli ASAP   hypothetical protein
eric|BBA-0003680 Escherichia coli ASAP   hypothetical protein
eric|BBA-0004766 Escherichia coli ASAP   hypothetical protein
eric|BBB-0000058 Escherichia coli ASAP   hypothetical protein
eric|BBB-0000839 Escherichia coli ASAP   hypothetical protein
eric|BBB-0000932 Escherichia coli ASAP   hypothetical protein
eric|BBB-0001247 Escherichia coli ASAP   hypothetical protein
eric|BBB-0001506 Escherichia coli ASAP   hypothetical protein
eric|BBB-0001531 Escherichia coli ASAP   hypothetical protein
eric|BBB-0001692 Escherichia coli ASAP   hypothetical protein
eric|BBB-0002735 Escherichia coli ASAP   hypothetical protein
eric|BBB-0003025 Escherichia coli ASAP   hypothetical protein
eric|BBB-0003700 Escherichia coli ASAP   hypothetical protein
eric|BBB-0003989 Escherichia coli ASAP   hypothetical protein
eric|BBB-0004017 Escherichia coli ASAP   hypothetical protein
eric|BBB-0004162 Escherichia coli ASAP   hypothetical protein
eric|BBB-0004269 Escherichia coli ASAP   hypothetical protein
eric|BBB-0004552 Escherichia coli ASAP   hypothetical protein
eric|BBB-0004617 Escherichia coli ASAP   hypothetical protein
eric|BBC-0000675 Escherichia coli ASAP   hypothetical protein
eric|BBC-0002240 Escherichia coli ASAP   hypothetical protein
eric|BBC-0002461 Escherichia coli ASAP   hypothetical protein
eric|BBC-0002620 Escherichia coli ASAP   hypothetical protein
eric|BBC-0002761 Escherichia coli ASAP   hypothetical protein
eric|BBC-0002951 Escherichia coli ASAP   hypothetical protein
eric|BBC-0003263 Escherichia coli ASAP   hypothetical protein
eric|BBC-0003911 Escherichia coli ASAP   hypothetical protein
eric|BBC-0004028 Escherichia coli ASAP   hypothetical protein
eric|BBC-0004618 Escherichia coli ASAP   hypothetical protein
fig|155864.1.peg.1718 Escherichia coli O157:H7 EDL933 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|155864.1.peg.1876 Escherichia coli O157:H7 EDL933 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|155864.1.peg.2114 Escherichia coli O157:H7 EDL933 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|155864.1.peg.2156 Escherichia coli O157:H7 EDL933 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|155864.1.peg.2763 Escherichia coli O157:H7 EDL933 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|155864.1.peg.2943 Escherichia coli O157:H7 EDL933 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|155864.1.peg.3487 Escherichia coli O157:H7 EDL933 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|155864.1.peg.3868 Escherichia coli O157:H7 EDL933 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|155864.1.peg.4027 Escherichia coli O157:H7 EDL933 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|155864.1.peg.5207 Escherichia coli O157:H7 EDL933 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|155864.8.peg.1515 Escherichia coli O157:H7 EDL933 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|155864.8.peg.1689 Escherichia coli O157:H7 EDL933 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|155864.8.peg.1943 Escherichia coli O157:H7 EDL933 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|155864.8.peg.1988 Escherichia coli O157:H7 EDL933 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|155864.8.peg.2637 Escherichia coli O157:H7 EDL933 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|155864.8.peg.2827 Escherichia coli O157:H7 EDL933 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|155864.8.peg.3403 Escherichia coli O157:H7 EDL933 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|155864.8.peg.3787 Escherichia coli O157:H7 EDL933 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|155864.8.peg.3958 Escherichia coli O157:H7 EDL933 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|155864.8.peg.5196 Escherichia coli O157:H7 EDL933 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|155864.8.peg.5649 Escherichia coli O157:H7 EDL933 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|194949.1.peg.151 Stx2 converting bacteriophage II FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|216592.1.peg.5141 Escherichia coli 042 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|216592.1.peg.5170 Escherichia coli 042 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|216592.1.peg.5182 Escherichia coli 042 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|216592.1.peg.5497 Escherichia coli 042 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|216592.1.peg.5661 Escherichia coli 042 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|216592.3.peg.5123 Escherichia coli 042 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|216592.3.peg.5132 Escherichia coli 042 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|340184.6.peg.5286 Escherichia coli B7A FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|340186.3.peg.2433 Escherichia coli E110019 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|340186.3.peg.4161 Escherichia coli E110019 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|340186.3.peg.4805 Escherichia coli E110019 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|340186.5.peg.2511 Escherichia coli E110019 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|340186.5.peg.4374 Escherichia coli E110019 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|340186.5.peg.5068 Escherichia coli E110019 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|386585.9.peg.1206 Escherichia coli O157:H7 str. Sakai FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|386585.9.peg.1313 Escherichia coli O157:H7 str. Sakai FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|386585.9.peg.1761 Escherichia coli O157:H7 str. Sakai FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|386585.9.peg.2025 Escherichia coli O157:H7 str. Sakai FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|386585.9.peg.2328 Escherichia coli O157:H7 str. Sakai FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|386585.9.peg.2878 Escherichia coli O157:H7 str. Sakai FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|386585.9.peg.3267 Escherichia coli O157:H7 str. Sakai FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|386585.9.peg.36 Escherichia coli O157:H7 str. Sakai FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|386585.9.peg.3645 Escherichia coli O157:H7 str. Sakai FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|386585.9.peg.4031 Escherichia coli O157:H7 str. Sakai FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|386585.9.peg.4203 Escherichia coli O157:H7 str. Sakai FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|386585.9.peg.5481 Escherichia coli O157:H7 str. Sakai FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444447.5.peg.1281 Escherichia coli O157:H7 str. EC4206 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444447.5.peg.1577 Escherichia coli O157:H7 str. EC4206 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444447.5.peg.200 Escherichia coli O157:H7 str. EC4206 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444447.5.peg.263 Escherichia coli O157:H7 str. EC4206 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444447.5.peg.3124 Escherichia coli O157:H7 str. EC4206 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444447.5.peg.3141 Escherichia coli O157:H7 str. EC4206 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444447.5.peg.4020 Escherichia coli O157:H7 str. EC4206 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444447.5.peg.41 Escherichia coli O157:H7 str. EC4206 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444447.5.peg.416 Escherichia coli O157:H7 str. EC4206 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444447.5.peg.4630 Escherichia coli O157:H7 str. EC4206 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444447.5.peg.4683 Escherichia coli O157:H7 str. EC4206 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444447.5.peg.5175 Escherichia coli O157:H7 str. EC4206 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444447.5.peg.544 Escherichia coli O157:H7 str. EC4206 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444447.5.peg.5777 Escherichia coli O157:H7 str. EC4206 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444447.5.peg.882 Escherichia coli O157:H7 str. EC4206 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444448.5.peg.1123 Escherichia coli O157:H7 str. EC4045 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444448.5.peg.131 Escherichia coli O157:H7 str. EC4045 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444448.5.peg.1415 Escherichia coli O157:H7 str. EC4045 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444448.5.peg.282 Escherichia coli O157:H7 str. EC4045 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444448.5.peg.2948 Escherichia coli O157:H7 str. EC4045 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444448.5.peg.2970 Escherichia coli O157:H7 str. EC4045 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444448.5.peg.3796 Escherichia coli O157:H7 str. EC4045 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444448.5.peg.409 Escherichia coli O157:H7 str. EC4045 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444448.5.peg.4814 Escherichia coli O157:H7 str. EC4045 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444448.5.peg.5306 Escherichia coli O157:H7 str. EC4045 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444448.5.peg.5352 Escherichia coli O157:H7 str. EC4045 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444448.5.peg.5423 Escherichia coli O157:H7 str. EC4045 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444448.5.peg.5595 Escherichia coli O157:H7 str. EC4045 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444448.5.peg.68 Escherichia coli O157:H7 str. EC4045 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444448.5.peg.737 Escherichia coli O157:H7 str. EC4045 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444449.5.peg.1016 Escherichia coli O157:H7 str. EC4042 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444449.5.peg.1066 Escherichia coli O157:H7 str. EC4042 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444449.5.peg.1148 Escherichia coli O157:H7 str. EC4042 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444449.5.peg.1306 Escherichia coli O157:H7 str. EC4042 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444449.5.peg.1368 Escherichia coli O157:H7 str. EC4042 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444449.5.peg.1523 Escherichia coli O157:H7 str. EC4042 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444449.5.peg.1653 Escherichia coli O157:H7 str. EC4042 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444449.5.peg.1983 Escherichia coli O157:H7 str. EC4042 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444449.5.peg.2370 Escherichia coli O157:H7 str. EC4042 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444449.5.peg.2663 Escherichia coli O157:H7 str. EC4042 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444449.5.peg.4194 Escherichia coli O157:H7 str. EC4042 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444449.5.peg.4524 Escherichia coli O157:H7 str. EC4042 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444449.5.peg.506 Escherichia coli O157:H7 str. EC4042 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444449.5.peg.5095 Escherichia coli O157:H7 str. EC4042 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444449.5.peg.5634 Escherichia coli O157:H7 str. EC4042 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444450.8.peg.1253 Escherichia coli O157:H7 str. EC4115 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444450.8.peg.1260 Escherichia coli O157:H7 str. EC4115 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444450.8.peg.1719 Escherichia coli O157:H7 str. EC4115 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444450.8.peg.22 Escherichia coli O157:H7 str. EC4115 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444450.8.peg.2325 Escherichia coli O157:H7 str. EC4115 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444450.8.peg.2813 Escherichia coli O157:H7 str. EC4115 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444450.8.peg.2860 Escherichia coli O157:H7 str. EC4115 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444450.8.peg.2942 Escherichia coli O157:H7 str. EC4115 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444450.8.peg.3221 Escherichia coli O157:H7 str. EC4115 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444450.8.peg.3372 Escherichia coli O157:H7 str. EC4115 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444450.8.peg.3499 Escherichia coli O157:H7 str. EC4115 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444450.8.peg.3825 Escherichia coli O157:H7 str. EC4115 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444450.8.peg.417 Escherichia coli O157:H7 str. EC4115 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444450.8.peg.4498 Escherichia coli O157:H7 str. EC4115 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444451.5.peg.1072 Escherichia coli O157:H7 str. EC4196 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444451.5.peg.2479 Escherichia coli O157:H7 str. EC4196 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444451.5.peg.3032 Escherichia coli O157:H7 str. EC4196 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444451.5.peg.3132 Escherichia coli O157:H7 str. EC4196 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444451.5.peg.3346 Escherichia coli O157:H7 str. EC4196 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444451.5.peg.3468 Escherichia coli O157:H7 str. EC4196 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444451.5.peg.3639 Escherichia coli O157:H7 str. EC4196 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444451.5.peg.4213 Escherichia coli O157:H7 str. EC4196 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444451.5.peg.4597 Escherichia coli O157:H7 str. EC4196 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444451.5.peg.4778 Escherichia coli O157:H7 str. EC4196 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444451.5.peg.4920 Escherichia coli O157:H7 str. EC4196 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444451.5.peg.5111 Escherichia coli O157:H7 str. EC4196 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444451.5.peg.5252 Escherichia coli O157:H7 str. EC4196 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444451.5.peg.5688 Escherichia coli O157:H7 str. EC4196 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444451.5.peg.626 Escherichia coli O157:H7 str. EC4196 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444451.5.peg.754 Escherichia coli O157:H7 str. EC4196 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444452.5.peg.1323 Escherichia coli O157:H7 str. EC4113 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444452.5.peg.2134 Escherichia coli O157:H7 str. EC4113 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444452.5.peg.2647 Escherichia coli O157:H7 str. EC4113 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444452.5.peg.3093 Escherichia coli O157:H7 str. EC4113 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444452.5.peg.3207 Escherichia coli O157:H7 str. EC4113 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444452.5.peg.3419 Escherichia coli O157:H7 str. EC4113 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444452.5.peg.4148 Escherichia coli O157:H7 str. EC4113 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444452.5.peg.4454 Escherichia coli O157:H7 str. EC4113 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444452.5.peg.4570 Escherichia coli O157:H7 str. EC4113 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444452.5.peg.4824 Escherichia coli O157:H7 str. EC4113 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444452.5.peg.5238 Escherichia coli O157:H7 str. EC4113 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444452.5.peg.5351 Escherichia coli O157:H7 str. EC4113 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444452.5.peg.5421 Escherichia coli O157:H7 str. EC4113 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444452.5.peg.5821 Escherichia coli O157:H7 str. EC4113 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444452.5.peg.652 Escherichia coli O157:H7 str. EC4113 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444453.5.peg.1628 Escherichia coli O157:H7 str. EC4076 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444453.5.peg.1756 Escherichia coli O157:H7 str. EC4076 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444453.5.peg.219 Escherichia coli O157:H7 str. EC4076 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444453.5.peg.2407 Escherichia coli O157:H7 str. EC4076 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444453.5.peg.3252 Escherichia coli O157:H7 str. EC4076 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444453.5.peg.3641 Escherichia coli O157:H7 str. EC4076 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444453.5.peg.3942 Escherichia coli O157:H7 str. EC4076 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444453.5.peg.4310 Escherichia coli O157:H7 str. EC4076 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444453.5.peg.4937 Escherichia coli O157:H7 str. EC4076 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444453.5.peg.5093 Escherichia coli O157:H7 str. EC4076 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444453.5.peg.5141 Escherichia coli O157:H7 str. EC4076 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444453.5.peg.5239 Escherichia coli O157:H7 str. EC4076 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444453.5.peg.5416 Escherichia coli O157:H7 str. EC4076 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444453.5.peg.5719 Escherichia coli O157:H7 str. EC4076 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444454.5.peg.1528 Escherichia coli O157:H7 str. EC4024 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444454.5.peg.1573 Escherichia coli O157:H7 str. EC4024 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444454.5.peg.1669 Escherichia coli O157:H7 str. EC4024 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444454.5.peg.1909 Escherichia coli O157:H7 str. EC4024 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444454.5.peg.2059 Escherichia coli O157:H7 str. EC4024 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444454.5.peg.2187 Escherichia coli O157:H7 str. EC4024 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444454.5.peg.2518 Escherichia coli O157:H7 str. EC4024 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444454.5.peg.2914 Escherichia coli O157:H7 str. EC4024 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444454.5.peg.3203 Escherichia coli O157:H7 str. EC4024 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444454.5.peg.4739 Escherichia coli O157:H7 str. EC4024 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444454.5.peg.5560 Escherichia coli O157:H7 str. EC4024 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444454.5.peg.5671 Escherichia coli O157:H7 str. EC4024 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444454.5.peg.5813 Escherichia coli O157:H7 str. EC4024 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444454.5.peg.601 Escherichia coli O157:H7 str. EC4024 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|444454.5.peg.6143 Escherichia coli O157:H7 str. EC4024 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478004.5.peg.1090 Escherichia coli O157:H7 str. EC4401 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478004.5.peg.1275 Escherichia coli O157:H7 str. EC4401 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478004.5.peg.1791 Escherichia coli O157:H7 str. EC4401 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478004.5.peg.1920 Escherichia coli O157:H7 str. EC4401 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478004.5.peg.2148 Escherichia coli O157:H7 str. EC4401 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478004.5.peg.2569 Escherichia coli O157:H7 str. EC4401 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478004.5.peg.3198 Escherichia coli O157:H7 str. EC4401 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478004.5.peg.3966 Escherichia coli O157:H7 str. EC4401 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478004.5.peg.4176 Escherichia coli O157:H7 str. EC4401 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478004.5.peg.4304 Escherichia coli O157:H7 str. EC4401 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478004.5.peg.5007 Escherichia coli O157:H7 str. EC4401 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478004.5.peg.5078 Escherichia coli O157:H7 str. EC4401 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478004.5.peg.809 Escherichia coli O157:H7 str. EC4401 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478006.5.peg.1074 Escherichia coli O157:H7 str. EC4501 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478006.5.peg.1816 Escherichia coli O157:H7 str. EC4501 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478006.5.peg.2380 Escherichia coli O157:H7 str. EC4501 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478006.5.peg.2569 Escherichia coli O157:H7 str. EC4501 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478006.5.peg.2867 Escherichia coli O157:H7 str. EC4501 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478006.5.peg.3081 Escherichia coli O157:H7 str. EC4501 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478006.5.peg.3581 Escherichia coli O157:H7 str. EC4501 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478006.5.peg.4234 Escherichia coli O157:H7 str. EC4501 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478006.5.peg.5063 Escherichia coli O157:H7 str. EC4501 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478006.5.peg.5323 Escherichia coli O157:H7 str. EC4501 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478006.5.peg.5370 Escherichia coli O157:H7 str. EC4501 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478006.5.peg.5690 Escherichia coli O157:H7 str. EC4501 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478006.5.peg.5800 Escherichia coli O157:H7 str. EC4501 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478006.5.peg.699 Escherichia coli O157:H7 str. EC4501 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478007.5.peg.1242 Escherichia coli O157:H7 str. EC508 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478007.5.peg.1362 Escherichia coli O157:H7 str. EC508 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478007.5.peg.3115 Escherichia coli O157:H7 str. EC508 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478007.5.peg.3186 Escherichia coli O157:H7 str. EC508 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478007.5.peg.3490 Escherichia coli O157:H7 str. EC508 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478007.5.peg.3918 Escherichia coli O157:H7 str. EC508 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478007.5.peg.432 Escherichia coli O157:H7 str. EC508 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478007.5.peg.4731 Escherichia coli O157:H7 str. EC508 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478007.5.peg.5174 Escherichia coli O157:H7 str. EC508 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478007.5.peg.5364 Escherichia coli O157:H7 str. EC508 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478007.5.peg.5512 Escherichia coli O157:H7 str. EC508 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478007.5.peg.5722 Escherichia coli O157:H7 str. EC508 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478007.5.peg.693 Escherichia coli O157:H7 str. EC508 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478008.5.peg.1181 Escherichia coli O157:H7 str. EC869 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478008.5.peg.1348 Escherichia coli O157:H7 str. EC869 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478008.5.peg.2672 Escherichia coli O157:H7 str. EC869 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478008.5.peg.3109 Escherichia coli O157:H7 str. EC869 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478008.5.peg.3966 Escherichia coli O157:H7 str. EC869 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478008.5.peg.4452 Escherichia coli O157:H7 str. EC869 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478008.5.peg.4613 Escherichia coli O157:H7 str. EC869 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478008.5.peg.4971 Escherichia coli O157:H7 str. EC869 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478008.5.peg.5242 Escherichia coli O157:H7 str. EC869 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|478008.5.peg.5419 Escherichia coli O157:H7 str. EC869 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|502346.5.peg.1389 Escherichia coli O157:H7 str. TW14588 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|502346.5.peg.2628 Escherichia coli O157:H7 str. TW14588 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|502346.5.peg.3077 Escherichia coli O157:H7 str. TW14588 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|502346.5.peg.3227 Escherichia coli O157:H7 str. TW14588 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|502346.5.peg.3394 Escherichia coli O157:H7 str. TW14588 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|502346.5.peg.3787 Escherichia coli O157:H7 str. TW14588 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|502346.5.peg.4246 Escherichia coli O157:H7 str. TW14588 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|502346.5.peg.4637 Escherichia coli O157:H7 str. TW14588 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|502346.5.peg.5168 Escherichia coli O157:H7 str. TW14588 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|502346.5.peg.5454 Escherichia coli O157:H7 str. TW14588 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|502346.5.peg.5656 Escherichia coli O157:H7 str. TW14588 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|502346.5.peg.83 Escherichia coli O157:H7 str. TW14588 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|502346.5.peg.972 Escherichia coli O157:H7 str. TW14588 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|544404.4.peg.1119 Escherichia coli O157:H7 str. TW14359 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|544404.4.peg.2189 Escherichia coli O157:H7 str. TW14359 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|544404.4.peg.2676 Escherichia coli O157:H7 str. TW14359 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|544404.4.peg.2722 Escherichia coli O157:H7 str. TW14359 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|544404.4.peg.280 Escherichia coli O157:H7 str. TW14359 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|544404.4.peg.2804 Escherichia coli O157:H7 str. TW14359 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|544404.4.peg.2961 Escherichia coli O157:H7 str. TW14359 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|544404.4.peg.297 Escherichia coli O157:H7 str. TW14359 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|544404.4.peg.3024 Escherichia coli O157:H7 str. TW14359 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|544404.4.peg.3175 Escherichia coli O157:H7 str. TW14359 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|544404.4.peg.3302 Escherichia coli O157:H7 str. TW14359 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|544404.4.peg.3629 Escherichia coli O157:H7 str. TW14359 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|544404.4.peg.4016 Escherichia coli O157:H7 str. TW14359 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|544404.4.peg.4308 Escherichia coli O157:H7 str. TW14359 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|544404.4.peg.5594 Escherichia coli O157:H7 str. TW14359 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|563769.2.peg.54 unclassified Lambda-like viruses Stx2-converting phage 1717 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|573235.3.peg.1145 Escherichia coli O26:H11 str. 11368 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|573235.3.peg.4167 Escherichia coli O26:H11 str. 11368 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|573235.3.peg.4482 Escherichia coli O26:H11 str. 11368 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|573235.3.peg.606 Escherichia coli O26:H11 str. 11368 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|573235.3.peg.866 Escherichia coli O26:H11 str. 11368 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|585396.4.peg.1089 Escherichia coli O111:H- str. 11128 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|585396.4.peg.1128 Escherichia coli O111:H- str. 11128 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|585396.4.peg.1270 Escherichia coli O111:H- str. 11128 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|585396.4.peg.1350 Escherichia coli O111:H- str. 11128 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|585396.4.peg.1478 Escherichia coli O111:H- str. 11128 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|585396.4.peg.1644 Escherichia coli O111:H- str. 11128 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|585396.4.peg.1666 Escherichia coli O111:H- str. 11128 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|585396.4.peg.1807 Escherichia coli O111:H- str. 11128 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|585396.4.peg.2036 Escherichia coli O111:H- str. 11128 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|585396.4.peg.2271 Escherichia coli O111:H- str. 11128 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|585396.4.peg.2387 Escherichia coli O111:H- str. 11128 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|585396.4.peg.2722 Escherichia coli O111:H- str. 11128 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|585396.4.peg.2728 Escherichia coli O111:H- str. 11128 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|585396.4.peg.2745 Escherichia coli O111:H- str. 11128 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|585396.4.peg.2768 Escherichia coli O111:H- str. 11128 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|585396.4.peg.2784 Escherichia coli O111:H- str. 11128 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|585396.4.peg.2787 Escherichia coli O111:H- str. 11128 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|585396.4.peg.315 Escherichia coli O111:H- str. 11128 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|585396.4.peg.326 Escherichia coli O111:H- str. 11128 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|585396.4.peg.3464 Escherichia coli O111:H- str. 11128 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|585396.4.peg.3484 Escherichia coli O111:H- str. 11128 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|585396.4.peg.3848 Escherichia coli O111:H- str. 11128 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|585396.4.peg.3902 Escherichia coli O111:H- str. 11128 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|585396.4.peg.4137 Escherichia coli O111:H- str. 11128 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|585396.4.peg.4465 Escherichia coli O111:H- str. 11128 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|585396.4.peg.4668 Escherichia coli O111:H- str. 11128 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|585396.4.peg.5207 Escherichia coli O111:H- str. 11128 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|585396.4.peg.5301 Escherichia coli O111:H- str. 11128 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|585396.4.peg.5396 Escherichia coli O111:H- str. 11128 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|585396.4.peg.5427 Escherichia coli O111:H- str. 11128 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|585396.4.peg.5517 Escherichia coli O111:H- str. 11128 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|585396.4.peg.5526 Escherichia coli O111:H- str. 11128 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|585396.4.peg.5628 Escherichia coli O111:H- str. 11128 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|585396.4.peg.5728 Escherichia coli O111:H- str. 11128 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|585396.4.peg.5767 Escherichia coli O111:H- str. 11128 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|585396.4.peg.5877 Escherichia coli O111:H- str. 11128 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|585396.4.peg.604 Escherichia coli O111:H- str. 11128 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|585396.4.peg.822 Escherichia coli O111:H- str. 11128 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|83334.1.peg.1149 Escherichia coli O157:H7 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|83334.1.peg.1265 Escherichia coli O157:H7 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|83334.1.peg.1710 Escherichia coli O157:H7 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|83334.1.peg.1948 Escherichia coli O157:H7 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|83334.1.peg.2249 Escherichia coli O157:H7 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|83334.1.peg.2756 Escherichia coli O157:H7 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|83334.1.peg.3127 Escherichia coli O157:H7 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|83334.1.peg.3487 Escherichia coli O157:H7 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|83334.1.peg.37 Escherichia coli O157:H7 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|83334.1.peg.3841 Escherichia coli O157:H7 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|83334.1.peg.3998 Escherichia coli O157:H7 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
fig|83334.1.peg.5221 Escherichia coli O157:H7 FIG   Insertion element IS401 (Burkholderia multivorans) transposase
gb|AAC70134.1 Escherichia coli O157:H7     hypothetical protein
gb|AAG56022.1 Escherichia coli O157:H7 EDL933     unknown in IS629
gb|AAG56180.1 Escherichia coli O157:H7 EDL933     putative transposase encoded within prophage CP-933O
gb|AAG56420.1 Escherichia coli O157:H7 EDL933     orf; hypothetical protein in IS629 within prophage CP-933R
gb|AAG56462.1 Escherichia coli O157:H7 EDL933     unknown protein in IS629
gb|AAG57009.1 Escherichia coli O157:H7 EDL933     unknown in IS629 encoded within prophage CP-933U
gb|AAG57190.1 Escherichia coli O157:H7 EDL933     unknown protein in IS629
gb|AAG57737.1 Escherichia coli O157:H7 EDL933     putative transposase
gb|AAG58119.1 Escherichia coli O157:H7 EDL933     unknown protein in IS629
gb|AAG58279.1 Escherichia coli O157:H7 EDL933     orf; hypothetical protein in IS629
gb|AAG59465.1 Escherichia coli O157:H7 EDL933     orf; hypothetical protein in IS
gb|ABW37153.1 Escherichia coli     putative transposase OrfA
gb|ACI34513.1 Escherichia coli O157:H7 str. EC4115     IS629, transposase orfA
gb|ACI34574.1 Escherichia coli O157:H7 str. EC4115     IS629, transposase orfA
gb|ACI35423.1 Escherichia coli O157:H7 str. EC4115     IS629, transposase orfA
gb|ACI35616.1 Escherichia coli O157:H7 str. EC4115     IS629, transposase orfA
gb|ACI35787.1 Escherichia coli O157:H7 str. EC4115     IS629, transposase orfA
gb|ACI36391.1 Escherichia coli O157:H7 str. EC4115     IS629, transposase orfA
gb|ACI36634.1 Escherichia coli O157:H7 str. EC4115     IS629, transposase orfA
gb|ACI37449.1 Escherichia coli O157:H7 str. EC4115     IS629, transposase orfA
gb|ACI38124.1 Escherichia coli O157:H7 str. EC4115     IS629, transposase orfA
gb|ACI38646.1 Escherichia coli O157:H7 str. EC4115     IS629, transposase orfA
gb|ACI38791.1 Escherichia coli O157:H7 str. EC4115     IS629, transposase orfA
gb|ACI39073.1 Escherichia coli O157:H7 str. EC4115     IS629, transposase orfA
gb|ACI39158.1 Escherichia coli O157:H7 str. EC4115     IS629, transposase orfA
gb|ACI39264.1 Escherichia coli O157:H7 str. EC4115     IS629, transposase orfA
gb|ACI43152.1 Stx2-converting phage 1717     putative transposase
gb|ACT70167.1 Escherichia coli O157:H7 str. TW14359     Transposase
gb|ACT70182.1 Escherichia coli O157:H7 str. TW14359     transposase
gb|ACT70959.1 Escherichia coli O157:H7 str. TW14359     transposase
gb|ACT71955.1 Escherichia coli O157:H7 str. TW14359     Transposase
gb|ACT72418.1 Escherichia coli O157:H7 str. TW14359     Transposase
gb|ACT72462.1 Escherichia coli O157:H7 str. TW14359     Transposase
gb|ACT72544.1 Escherichia coli O157:H7 str. TW14359     Transposase
gb|ACT72704.1 Escherichia coli O157:H7 str. TW14359     Transposase
gb|ACT72758.1 Escherichia coli O157:H7 str. TW14359     Transposase
gb|ACT72901.1 Escherichia coli O157:H7 str. TW14359     Transposase
gb|ACT73018.1 Escherichia coli O157:H7 str. TW14359     Transposase
gb|ACT73334.1 Escherichia coli O157:H7 str. TW14359     Transposase
gb|ACT73698.1 Escherichia coli O157:H7 str. TW14359     Transposase
gb|ACT73974.1 Escherichia coli O157:H7 str. TW14359     Transposase
gb|ACT75198.1 Escherichia coli O157:H7 str. TW14359     hypothetical protein ECSP_6038
gb|AE005334_9 Escherichia coli O157:H7 EDL933     unknown in IS629
gb|AE005347_12 Escherichia coli O157:H7 EDL933     putative transposase encoded within prophage CP-933O
gb|AE005369_9 Escherichia coli O157:H7 EDL933     orf; hypothetical protein in IS629 within prophage CP-933R
gb|AE005372_7 Escherichia coli O157:H7 EDL933     unknown protein in IS629
gb|AE005420_14 Escherichia coli O157:H7 EDL933     unknown in IS629 encoded within prophage CP-933U
gb|AE005439_9 Escherichia coli O157:H7 EDL933     unknown protein in IS629
gb|AE005492_6 Escherichia coli O157:H7 EDL933     putative transposase
gb|AE005528_9 Escherichia coli O157:H7 EDL933     unknown protein in IS629
gb|AE005543_9 Escherichia coli O157:H7 EDL933     orf; hypothetical protein in IS629
gb|AE005658_7 Escherichia coli O157:H7 EDL933     orf; hypothetical protein in IS
gb|EDU30868.1 Escherichia coli O157:H7 str. EC4196     IS1203 transposase orfA
gb|EDU30974.1 Escherichia coli O157:H7 str. EC4196     IS629 transposase orfA
gb|EDU31151.1 Escherichia coli O157:H7 str. EC4196     IS629 transposase orfA
gb|EDU31258.1 Escherichia coli O157:H7 str. EC4196     IS1203 transposase orfA
gb|EDU31422.1 Escherichia coli O157:H7 str. EC4196     IS629 transposase orfA
gb|EDU31781.1 Escherichia coli O157:H7 str. EC4196     IS629 transposase orfA
gb|EDU32272.1 Escherichia coli O157:H7 str. EC4196     IS629 transposase orfA
gb|EDU32420.1 Escherichia coli O157:H7 str. EC4196     IS629 transposase orfA
gb|EDU32566.1 Escherichia coli O157:H7 str. EC4196     IS629 transposase orfA
gb|EDU32788.1 Escherichia coli O157:H7 str. EC4196     IS1203 transposase orfA
gb|EDU32876.1 Escherichia coli O157:H7 str. EC4196     IS1203 transposase orfA
gb|EDU33417.1 Escherichia coli O157:H7 str. EC4196     IS629 transposase orfA
gb|EDU34612.1 Escherichia coli O157:H7 str. EC4196     IS629 transposase orfA
gb|EDU35073.1 Escherichia coli O157:H7 str. EC4196     IS629 transposase orfA
gb|EDU35120.1 Escherichia coli O157:H7 str. EC4196     IS629 transposase orfA
gb|EDU51730.1 Escherichia coli O157:H7 str. EC4113     IS629 transposase orfA
gb|EDU51771.1 Escherichia coli O157:H7 str. EC4113     IS629 transposase orfA
gb|EDU51870.1 Escherichia coli O157:H7 str. EC4113     IS629 transposase orfA
gb|EDU52207.1 Escherichia coli O157:H7 str. EC4113     IS629 transposase orfA
gb|EDU52469.1 Escherichia coli O157:H7 str. EC4113     IS1203 transposase orfA
gb|EDU52537.1 Escherichia coli O157:H7 str. EC4113     IS629 transposase orfA
gb|EDU52816.1 Escherichia coli O157:H7 str. EC4113     IS1203 transposase orfA
gb|EDU53443.1 Escherichia coli O157:H7 str. EC4113     IS1203 transposase orfA
gb|EDU53693.1 Escherichia coli O157:H7 str. EC4113     IS1203 transposase orfA
gb|EDU53780.1 Escherichia coli O157:H7 str. EC4113     IS629 transposase orfA
gb|EDU54207.1 Escherichia coli O157:H7 str. EC4113     IS629 transposase orfA
gb|EDU54564.1 Escherichia coli O157:H7 str. EC4113     IS1203 transposase orfA
gb|EDU55371.1 Escherichia coli O157:H7 str. EC4113     IS629 transposase orfA
gb|EDU55973.1 Escherichia coli O157:H7 str. EC4113     IS629 transposase orfA
gb|EDU67583.1 Escherichia coli O157:H7 str. EC4076     IS629 transposase orfA
gb|EDU67736.1 Escherichia coli O157:H7 str. EC4076     IS629 transposase orfA
gb|EDU67811.1 Escherichia coli O157:H7 str. EC4076     IS629 transposase orfA
gb|EDU67853.1 Escherichia coli O157:H7 str. EC4076     IS629 transposase orfA
gb|EDU68018.1 Escherichia coli O157:H7 str. EC4076     IS1203 transposase orfA
gb|EDU68582.1 Escherichia coli O157:H7 str. EC4076     IS629 transposase orfA
gb|EDU68865.1 Escherichia coli O157:H7 str. EC4076     IS1203 transposase orfA
gb|EDU69171.1 Escherichia coli O157:H7 str. EC4076     IS1203 transposase orfA
gb|EDU69497.1 Escherichia coli O157:H7 str. EC4076     IS629 transposase orfA
gb|EDU70134.1 Escherichia coli O157:H7 str. EC4076     IS1203 transposase orfA
gb|EDU70936.1 Escherichia coli O157:H7 str. EC4076     IS629 transposase orfA
gb|EDU70954.1 Escherichia coli O157:H7 str. EC4076     IS629 transposase orfA
gb|EDU72182.1 Escherichia coli O157:H7 str. EC4076     IS629 transposase orfA
gb|EDU73099.1 Escherichia coli O157:H7 str. EC4401     IS629 transposase orfA
gb|EDU73176.1 Escherichia coli O157:H7 str. EC4401     IS629 transposase orfA
gb|EDU73749.1 Escherichia coli O157:H7 str. EC4401     IS1203 transposase orfA
gb|EDU73910.1 Escherichia coli O157:H7 str. EC4401     IS1203 transposase orfA
gb|EDU74106.1 Escherichia coli O157:H7 str. EC4401     IS629 transposase orfA
gb|EDU74743.1 Escherichia coli O157:H7 str. EC4401     IS629 transposase orfA
gb|EDU75388.1 Escherichia coli O157:H7 str. EC4401     IS1203 transposase orfA
gb|EDU75710.1 Escherichia coli O157:H7 str. EC4401     IS629 transposase orfA
gb|EDU76071.1 Escherichia coli O157:H7 str. EC4401     IS629 transposase orfA
gb|EDU76108.1 Escherichia coli O157:H7 str. EC4401     IS629 transposase orfA
gb|EDU76578.1 Escherichia coli O157:H7 str. EC4401     IS1203 transposase orfA
gb|EDU76748.1 Escherichia coli O157:H7 str. EC4401     IS1203 transposase orfA
gb|EDU76826.1 Escherichia coli O157:H7 str. EC4401     IS629 transposase orfA
gb|EDU78118.1 Escherichia coli O157:H7 str. EC4486     IS1203 transposase orfA
gb|EDU78578.1 Escherichia coli O157:H7 str. EC4486     IS629 transposase orfA
gb|EDU79212.1 Escherichia coli O157:H7 str. EC4486     IS629 transposase orfA
gb|EDU79655.1 Escherichia coli O157:H7 str. EC4486     IS1203 transposase orfA
gb|EDU79783.1 Escherichia coli O157:H7 str. EC4486     IS1203 transposase orfA
gb|EDU80118.1 Escherichia coli O157:H7 str. EC4486     IS629 transposase orfA
gb|EDU80172.1 Escherichia coli O157:H7 str. EC4486     IS629 transposase orfA
gb|EDU80541.1 Escherichia coli O157:H7 str. EC4486     IS629 transposase orfA
gb|EDU81247.1 Escherichia coli O157:H7 str. EC4486     IS629 transposase orfA
gb|EDU81260.1 Escherichia coli O157:H7 str. EC4486     IS629 transposase orfA
gb|EDU81538.1 Escherichia coli O157:H7 str. EC4486     IS1203 transposase orfA
gb|EDU81704.1 Escherichia coli O157:H7 str. EC4486     IS1203 transposase orfA
gb|EDU82139.1 Escherichia coli O157:H7 str. EC4486     IS629 transposase orfA
gb|EDU83260.1 Escherichia coli O157:H7 str. EC4501     IS629 transposase orfA
gb|EDU83438.1 Escherichia coli O157:H7 str. EC4501     IS629 transposase orfA
gb|EDU83466.1 Escherichia coli O157:H7 str. EC4501     IS629 transposase orfA
gb|EDU83677.1 Escherichia coli O157:H7 str. EC4501     IS1203 transposase orfA
gb|EDU84424.1 Escherichia coli O157:H7 str. EC4501     IS629 transposase orfA
gb|EDU85003.1 Escherichia coli O157:H7 str. EC4501     IS1203 transposase orfA
gb|EDU85436.1 Escherichia coli O157:H7 str. EC4501     IS629 transposase orfA
gb|EDU85659.1 Escherichia coli O157:H7 str. EC4501     IS629 transposase orfA
gb|EDU85974.1 Escherichia coli O157:H7 str. EC4501     IS629 transposase orfA
gb|EDU86153.1 Escherichia coli O157:H7 str. EC4501     IS629 transposase orfA
gb|EDU86706.1 Escherichia coli O157:H7 str. EC4501     IS629 transposase orfA
gb|EDU87417.1 Escherichia coli O157:H7 str. EC4501     IS1203 transposase orfA
gb|EDU87800.1 Escherichia coli O157:H7 str. EC4501     IS629 transposase orfA
gb|EDU88533.1 Escherichia coli O157:H7 str. EC869     IS629 transposase orfA
gb|EDU88697.1 Escherichia coli O157:H7 str. EC869     IS629 transposase orfA
gb|EDU88933.1 Escherichia coli O157:H7 str. EC869     IS629 transposase orfA
gb|EDU89274.1 Escherichia coli O157:H7 str. EC869     IS629 transposase orfA
gb|EDU89438.1 Escherichia coli O157:H7 str. EC869     IS629 transposase orfA
gb|EDU89925.1 Escherichia coli O157:H7 str. EC869     IS1203 transposase orfA
gb|EDU90738.1 Escherichia coli O157:H7 str. EC869     IS629 transposase orfA
gb|EDU91018.1 Escherichia coli O157:H7 str. EC869     IS1203 transposase orfA
gb|EDU92194.1 Escherichia coli O157:H7 str. EC869     IS629 transposase orfA
gb|EDU92340.1 Escherichia coli O157:H7 str. EC869     IS629 transposase orfA
gb|EDU93651.1 Escherichia coli O157:H7 str. EC508     IS629 transposase orfA
gb|EDU93716.1 Escherichia coli O157:H7 str. EC508     IS1203 transposase orfA
gb|EDU93849.1 Escherichia coli O157:H7 str. EC508     IS1203 transposase orfA
gb|EDU94238.1 Escherichia coli O157:H7 str. EC508     IS629 transposase orfA
gb|EDU94963.1 Escherichia coli O157:H7 str. EC508     IS1203 transposase orfA
gb|EDU95284.1 Escherichia coli O157:H7 str. EC508     IS629 transposase orfA
gb|EDU95557.1 Escherichia coli O157:H7 str. EC508     IS629 transposase orfA
gb|EDU95695.1 Escherichia coli O157:H7 str. EC508     IS629 transposase orfA
gb|EDU97299.1 Escherichia coli O157:H7 str. EC508     IS1203 transposase orfA
gb|EDU97373.1 Escherichia coli O157:H7 str. EC508     IS629 transposase orfA
gb|EDU97886.1 Escherichia coli O157:H7 str. EC508     IS1203 transposase orfA
gb|EDU98155.1 Escherichia coli O157:H7 str. EC508     IS629 transposase orfA
gb|EDV60054.1 Escherichia coli B7A     IS629 transposase orfA
gb|EDV85614.1 Escherichia coli E110019     IS629 transposase orfA
gb|EDV86199.1 Escherichia coli E110019     IS629 transposase orfA
gb|EDV87867.1 Escherichia coli E110019     IS629 transposase orfA
gb|EDZ74461.1 Escherichia coli O157:H7 str. EC4206     IS629, transposase orfA
gb|EDZ74652.1 Escherichia coli O157:H7 str. EC4206     IS629, transposase orfA
gb|EDZ74890.1 Escherichia coli O157:H7 str. EC4206     IS629, transposase orfA
gb|EDZ75142.1 Escherichia coli O157:H7 str. EC4206     IS629, transposase orfA
gb|EDZ75446.1 Escherichia coli O157:H7 str. EC4206     IS629, transposase orfA
gb|EDZ75485.1 Escherichia coli O157:H7 str. EC4206     IS629, transposase orfA
gb|EDZ76033.1 Escherichia coli O157:H7 str. EC4206     IS629, transposase orfA
gb|EDZ76217.1 Escherichia coli O157:H7 str. EC4206     IS629, transposase orfA
gb|EDZ76297.1 Escherichia coli O157:H7 str. EC4206     IS629, transposase orfA
gb|EDZ76460.1 Escherichia coli O157:H7 str. EC4206     IS629, transposase orfA
gb|EDZ77094.1 Escherichia coli O157:H7 str. EC4206     IS629, transposase orfA
gb|EDZ77193.1 Escherichia coli O157:H7 str. EC4206     IS629, transposase orfA
gb|EDZ77723.1 Escherichia coli O157:H7 str. EC4206     IS629, transposase orfA
gb|EDZ78357.1 Escherichia coli O157:H7 str. EC4206     IS629, transposase orfA
gb|EDZ79164.1 Escherichia coli O157:H7 str. EC4206     IS629, transposase orfA
gb|EDZ79326.1 Escherichia coli O157:H7 str. EC4045     IS629, transposase orfA
gb|EDZ79480.1 Escherichia coli O157:H7 str. EC4045     IS629, transposase orfA
gb|EDZ79804.1 Escherichia coli O157:H7 str. EC4045     IS629, transposase orfA
gb|EDZ79853.1 Escherichia coli O157:H7 str. EC4045     IS629, transposase orfA
gb|EDZ79867.1 Escherichia coli O157:H7 str. EC4045     IS629, transposase orfA
gb|EDZ80177.1 Escherichia coli O157:H7 str. EC4045     IS629, transposase orfA
gb|EDZ81454.1 Escherichia coli O157:H7 str. EC4045     IS629, transposase orfA
gb|EDZ82424.1 Escherichia coli O157:H7 str. EC4045     IS629, transposase orfA
gb|EDZ82480.1 Escherichia coli O157:H7 str. EC4045     IS629, transposase orfA
gb|EDZ82989.1 Escherichia coli O157:H7 str. EC4045     IS629, transposase orfA
gb|EDZ83042.1 Escherichia coli O157:H7 str. EC4045     IS629, transposase orfA
gb|EDZ83167.1 Escherichia coli O157:H7 str. EC4045     IS629, transposase orfA
gb|EDZ83406.1 Escherichia coli O157:H7 str. EC4045     IS629, transposase orfA
gb|EDZ84459.1 Escherichia coli O157:H7 str. EC4045     IS629, transposase orfA
gb|EDZ84486.1 Escherichia coli O157:H7 str. EC4045     IS629, transposase orfA
gb|EDZ84621.1 Escherichia coli O157:H7 str. EC4042     IS629, transposase orfA
gb|EDZ84907.1 Escherichia coli O157:H7 str. EC4042     IS629, transposase orfA
gb|EDZ85388.1 Escherichia coli O157:H7 str. EC4042     IS629, transposase orfA
gb|EDZ86361.1 Escherichia coli O157:H7 str. EC4042     IS629, transposase orfA
gb|EDZ86523.1 Escherichia coli O157:H7 str. EC4042     IS629, transposase orfA
gb|EDZ86623.1 Escherichia coli O157:H7 str. EC4042     IS629, transposase orfA
gb|EDZ86888.1 Escherichia coli O157:H7 str. EC4042     IS629, transposase orfA
gb|EDZ87127.1 Escherichia coli O157:H7 str. EC4042     IS629, transposase orfA
gb|EDZ87301.1 Escherichia coli O157:H7 str. EC4042     IS629, transposase orfA
gb|EDZ87388.1 Escherichia coli O157:H7 str. EC4042     IS629, transposase orfA
gb|EDZ87973.1 Escherichia coli O157:H7 str. EC4042     IS629, transposase orfA
gb|EDZ88147.1 Escherichia coli O157:H7 str. EC4042     IS629, transposase orfA
gb|EDZ88221.1 Escherichia coli O157:H7 str. EC4042     IS629, transposase orfA
gb|EDZ89367.1 Escherichia coli O157:H7 str. EC4042     IS629, transposase orfA
gb|EDZ89579.1 Escherichia coli O157:H7 str. EC4042     IS629, transposase orfA
gb|EEC25507.1 Escherichia coli O157:H7 str. TW14588     IS629, transposase orfA
gb|EEC25653.1 Escherichia coli O157:H7 str. TW14588     IS629, transposase orfA
gb|EEC25786.1 Escherichia coli O157:H7 str. TW14588     IS629, transposase orfA
gb|EEC26186.1 Escherichia coli O157:H7 str. TW14588     IS629, transposase orfA
gb|EEC27247.1 Escherichia coli O157:H7 str. TW14588     IS629, transposase orfA
gb|EEC27285.1 Escherichia coli O157:H7 str. TW14588     IS629, transposase orfA
gb|EEC27461.1 Escherichia coli O157:H7 str. TW14588     IS629, transposase orfA
gb|EEC27983.1 Escherichia coli O157:H7 str. TW14588     IS629, transposase orfA
gb|EEC28389.1 Escherichia coli O157:H7 str. TW14588     IS629, transposase orfA
gb|EEC28411.1 Escherichia coli O157:H7 str. TW14588     IS629, transposase orfA
gb|EEC29478.1 Escherichia coli O157:H7 str. TW14588     IS629, transposase orfA
gb|EEC30866.1 Escherichia coli O157:H7 str. TW14588     IS629, transposase orfA
gb|EEC31009.1 Escherichia coli O157:H7 str. TW14588     IS629, transposase orfA
gi|10955297 Escherichia coli O157:H7 str. Sakai NCBI   hypothetical protein pO157p83
gi|109627374 Escherichia coli NCBI   hypothetical protein
gi|12514865 Escherichia coli O157:H7 EDL933 NCBI   unknown in IS629
gi|12515062 Escherichia coli O157:H7 EDL933 NCBI   putative transposase encoded within prophage CP-933O
gi|12515369 Escherichia coli O157:H7 EDL933 NCBI   orf; hypothetical protein in IS629 within prophage CP-933R
gi|12515420 Escherichia coli O157:H7 EDL933 NCBI   unknown protein in IS629
gi|12516110 Escherichia coli O157:H7 EDL933 NCBI   unknown in IS629 encoded within prophage CP-933U
gi|12516348 Escherichia coli O157:H7 EDL933 NCBI   unknown protein in IS629
gi|12517054 Escherichia coli O157:H7 EDL933 NCBI   putative transposase
gi|12517543 Escherichia coli O157:H7 EDL933 NCBI   unknown protein in IS629
gi|12517748 Escherichia coli O157:H7 EDL933 NCBI   orf; hypothetical protein in IS629
gi|12519278 Escherichia coli O157:H7 EDL933 NCBI   orf; hypothetical protein in IS
gi|13360549 Escherichia coli O157:H7 str. Sakai NCBI   putative transposase OrfA protein of insertion sequence IS629
gi|13360669 Escherichia coli O157:H7 str. Sakai NCBI   putative transposase OrfA protein of insertion sequence IS629
gi|13361129 Escherichia coli O157:H7 str. Sakai NCBI   putative transposase OrfA protein of insertion sequence IS629
gi|13361384 Escherichia coli O157:H7 str. Sakai NCBI   putative transposase OrfA protein of insertion sequence IS629
gi|13361686 Escherichia coli O157:H7 str. Sakai NCBI   putative transposase OrfA protein of insertion sequence IS629
gi|13362212 Escherichia coli O157:H7 str. Sakai NCBI   putative transposase OrfA protein of insertion sequence IS629
gi|13362602 Escherichia coli O157:H7 str. Sakai NCBI   putative transposase OrfA protein of insertion sequence IS629
gi|13362961 Escherichia coli O157:H7 str. Sakai NCBI   putative transposase OrfA protein of insertion sequence IS629
gi|13363335 Escherichia coli O157:H7 str. Sakai NCBI   putative transposase OrfA protein of insertion sequence IS629
gi|13363497 Escherichia coli O157:H7 str. Sakai NCBI   putative transposase OrfA protein of insertion sequence IS629
gi|13364721 Escherichia coli O157:H7 str. Sakai NCBI   putative transposase OrfA protein of insertion sequence IS629
gi|14325232 Escherichia coli NCBI   ORFa
gi|157166062 Phage BP-4795 NCBI   putative transposase OrfA protein of IS629
gi|15801393 Escherichia coli O157:H7 EDL933 NCBI   unknown in IS629
gi|15801551 Escherichia coli O157:H7 EDL933 NCBI   putative transposase encoded within prophage CP-933O
gi|15801788 Escherichia coli O157:H7 EDL933 NCBI   hypothetical protein Z2375
gi|15801830 Escherichia coli O157:H7 EDL933 NCBI   unknown protein in IS629
gi|15802429 Escherichia coli O157:H7 EDL933 NCBI   unknown in IS629 encoded within prophage CP-933U
gi|15802608 Escherichia coli O157:H7 EDL933 NCBI   unknown protein in IS629
gi|15803147 Escherichia coli O157:H7 EDL933 NCBI   putative transposase
gi|15803527 Escherichia coli O157:H7 EDL933 NCBI   unknown protein in IS629
gi|15803685 Escherichia coli O157:H7 EDL933 NCBI   hypothetical protein Z4502
gi|15804858 Escherichia coli O157:H7 EDL933 NCBI   hypothetical protein Z5879
gi|15830343 Escherichia coli O157:H7 str. Sakai NCBI   putative transposase
gi|15830463 Escherichia coli O157:H7 str. Sakai NCBI   putative transposase
gi|15830919 Escherichia coli O157:H7 str. Sakai NCBI   putative transposase
gi|15831173 Escherichia coli O157:H7 str. Sakai NCBI   putative transposase
gi|15831474 Escherichia coli O157:H7 str. Sakai NCBI   putative transposase
gi|15831998 Escherichia coli O157:H7 str. Sakai NCBI   putative transposase
gi|15832386 Escherichia coli O157:H7 str. Sakai NCBI   putative transposase
gi|15832744 Escherichia coli O157:H7 str. Sakai NCBI   putative transposase
gi|15833117 Escherichia coli O157:H7 str. Sakai NCBI   putative transposase
gi|15833278 Escherichia coli O157:H7 str. Sakai NCBI   putative transposase
gi|15834497 Escherichia coli O157:H7 str. Sakai NCBI   putative transposase
gi|158347582 Escherichia coli NCBI   putative transposase OrfA
gi|165975427 Escherichia coli NCBI   putative transposase OrfA
gi|168747519 Escherichia coli O157:H7 str. EC4113 NCBI   IS629 transposase orfA
gi|168748230 Escherichia coli O157:H7 str. EC4113 NCBI   IS629 transposase orfA
gi|168749105 Escherichia coli O157:H7 str. EC4113 NCBI   IS1203 transposase orfA
gi|168749654 Escherichia coli O157:H7 str. EC4113 NCBI   IS629 transposase orfA
gi|168750109 Escherichia coli O157:H7 str. EC4113 NCBI   IS629 transposase orfA
gi|168750232 Escherichia coli O157:H7 str. EC4113 NCBI   IS1203 transposase orfA
gi|168750470 Escherichia coli O157:H7 str. EC4113 NCBI   IS1203 transposase orfA
gi|168751239 Escherichia coli O157:H7 str. EC4113 NCBI   IS1203 transposase orfA
gi|168751553 Escherichia coli O157:H7 str. EC4113 NCBI   IS629 transposase orfA
gi|168751676 Escherichia coli O157:H7 str. EC4113 NCBI   IS1203 transposase orfA
gi|168751939 Escherichia coli O157:H7 str. EC4113 NCBI   IS629 transposase orfA
gi|168752391 Escherichia coli O157:H7 str. EC4113 NCBI   IS629 transposase orfA
gi|168752509 Escherichia coli O157:H7 str. EC4113 NCBI   IS629 transposase orfA
gi|168752588 Escherichia coli O157:H7 str. EC4113 NCBI   IS629 transposase orfA
gi|168753941 Escherichia coli O157:H7 str. EC4401 NCBI   IS629 transposase orfA
gi|168754249 Escherichia coli O157:H7 str. EC4401 NCBI   IS1203 transposase orfA
gi|168754460 Escherichia coli O157:H7 str. EC4401 NCBI   IS1203 transposase orfA
gi|168754997 Escherichia coli O157:H7 str. EC4401 NCBI   IS629 transposase orfA
gi|168755132 Escherichia coli O157:H7 str. EC4401 NCBI   IS629 transposase orfA
gi|168755370 Escherichia coli O157:H7 str. EC4401 NCBI   IS629 transposase orfA
gi|168755807 Escherichia coli O157:H7 str. EC4401 NCBI   IS1203 transposase orfA
gi|168756482 Escherichia coli O157:H7 str. EC4401 NCBI   IS629 transposase orfA
gi|168757295 Escherichia coli O157:H7 str. EC4401 NCBI   IS629 transposase orfA
gi|168757540 Escherichia coli O157:H7 str. EC4401 NCBI   IS1203 transposase orfA
gi|168757672 Escherichia coli O157:H7 str. EC4401 NCBI   IS1203 transposase orfA
gi|168758427 Escherichia coli O157:H7 str. EC4401 NCBI   IS629 transposase orfA
gi|168758503 Escherichia coli O157:H7 str. EC4401 NCBI   IS629 transposase orfA
gi|168760132 Escherichia coli O157:H7 str. EC4501 NCBI   IS629 transposase orfA
gi|168760521 Escherichia coli O157:H7 str. EC4501 NCBI   IS1203 transposase orfA
gi|168761317 Escherichia coli O157:H7 str. EC4501 NCBI   IS629 transposase orfA
gi|168761902 Escherichia coli O157:H7 str. EC4501 NCBI   IS629 transposase orfA
gi|168762107 Escherichia coli O157:H7 str. EC4501 NCBI   IS629 transposase orfA
gi|168762419 Escherichia coli O157:H7 str. EC4501 NCBI   IS629 transposase orfA
gi|168762646 Escherichia coli O157:H7 str. EC4501 NCBI   IS629 transposase orfA
gi|168763163 Escherichia coli O157:H7 str. EC4501 NCBI   IS1203 transposase orfA
gi|168763875 Escherichia coli O157:H7 str. EC4501 NCBI   IS629 transposase orfA
gi|168764777 Escherichia coli O157:H7 str. EC4501 NCBI   IS1203 transposase orfA
gi|168765065 Escherichia coli O157:H7 str. EC4501 NCBI   IS629 transposase orfA
gi|168765117 Escherichia coli O157:H7 str. EC4501 NCBI   IS629 transposase orfA
gi|168765476 Escherichia coli O157:H7 str. EC4501 NCBI   IS629 transposase orfA
gi|168766995 Escherichia coli O157:H7 str. EC4486 NCBI   IS629 transposase orfA
gi|168767428 Escherichia coli O157:H7 str. EC4486 NCBI   IS1203 transposase orfA
gi|168767638 Escherichia coli O157:H7 str. EC4486 NCBI   IS1203 transposase orfA
gi|168767871 Escherichia coli O157:H7 str. EC4486 NCBI   IS629 transposase orfA
gi|168768006 Escherichia coli O157:H7 str. EC4486 NCBI   IS629 transposase orfA
gi|168768714 Escherichia coli O157:H7 str. EC4486 NCBI   IS629 transposase orfA
gi|168769137 Escherichia coli O157:H7 str. EC4486 NCBI   IS629 transposase orfA
gi|168769240 Escherichia coli O157:H7 str. EC4486 NCBI   IS629 transposase orfA
gi|168769608 Escherichia coli O157:H7 str. EC4486 NCBI   IS1203 transposase orfA
gi|168769746 Escherichia coli O157:H7 str. EC4486 NCBI   IS1203 transposase orfA
gi|168770309 Escherichia coli O157:H7 str. EC4486 NCBI   IS629 transposase orfA
gi|168771011 Escherichia coli O157:H7 str. EC4486 NCBI   IS629 transposase orfA
gi|168771563 Escherichia coli O157:H7 str. EC4486 NCBI   IS1203 transposase orfA
gi|168772893 Escherichia coli O157:H7 str. EC4196 NCBI   IS629 transposase orfA
gi|168773030 Escherichia coli O157:H7 str. EC4196 NCBI   IS629 transposase orfA
gi|168773372 Escherichia coli O157:H7 str. EC4196 NCBI   IS629 transposase orfA
gi|168774845 Escherichia coli O157:H7 str. EC4196 NCBI   IS629 transposase orfA
gi|168775446 Escherichia coli O157:H7 str. EC4196 NCBI   IS1203 transposase orfA
gi|168775557 Escherichia coli O157:H7 str. EC4196 NCBI   IS1203 transposase orfA
gi|168775799 Escherichia coli O157:H7 str. EC4196 NCBI   IS629 transposase orfA
gi|168775926 Escherichia coli O157:H7 str. EC4196 NCBI   IS629 transposase orfA
gi|168776112 Escherichia coli O157:H7 str. EC4196 NCBI   IS629 transposase orfA
gi|168776726 Escherichia coli O157:H7 str. EC4196 NCBI   IS629 transposase orfA
gi|168777124 Escherichia coli O157:H7 str. EC4196 NCBI   IS629 transposase orfA
gi|168777325 Escherichia coli O157:H7 str. EC4196 NCBI   IS1203 transposase orfA
gi|168777480 Escherichia coli O157:H7 str. EC4196 NCBI   IS629 transposase orfA
gi|168777689 Escherichia coli O157:H7 str. EC4196 NCBI   IS629 transposase orfA
gi|168777830 Escherichia coli O157:H7 str. EC4196 NCBI   IS1203 transposase orfA
gi|168778604 Escherichia coli O157:H7 str. EC4076 NCBI   IS629 transposase orfA
gi|168780100 Escherichia coli O157:H7 str. EC4076 NCBI   IS629 transposase orfA
gi|168780237 Escherichia coli O157:H7 str. EC4076 NCBI   IS629 transposase orfA
gi|168780948 Escherichia coli O157:H7 str. EC4076 NCBI   IS1203 transposase orfA
gi|168781848 Escherichia coli O157:H7 str. EC4076 NCBI   IS629 transposase orfA
gi|168782278 Escherichia coli O157:H7 str. EC4076 NCBI   IS1203 transposase orfA
gi|168782605 Escherichia coli O157:H7 str. EC4076 NCBI   IS1203 transposase orfA
gi|168783009 Escherichia coli O157:H7 str. EC4076 NCBI   IS629 transposase orfA
gi|168783668 Escherichia coli O157:H7 str. EC4076 NCBI   IS1203 transposase orfA
gi|168783842 Escherichia coli O157:H7 str. EC4076 NCBI   IS629 transposase orfA
gi|168783893 Escherichia coli O157:H7 str. EC4076 NCBI   IS629 transposase orfA
gi|168783987 Escherichia coli O157:H7 str. EC4076 NCBI   IS629 transposase orfA
gi|168784179 Escherichia coli O157:H7 str. EC4076 NCBI   IS629 transposase orfA
gi|168785846 Escherichia coli O157:H7 str. EC869 NCBI   IS629 transposase orfA
gi|168786026 Escherichia coli O157:H7 str. EC869 NCBI   IS629 transposase orfA
gi|168787435 Escherichia coli O157:H7 str. EC869 NCBI   IS1203 transposase orfA
gi|168787904 Escherichia coli O157:H7 str. EC869 NCBI   IS629 transposase orfA
gi|168788819 Escherichia coli O157:H7 str. EC869 NCBI   IS1203 transposase orfA
gi|168789369 Escherichia coli O157:H7 str. EC869 NCBI   IS629 transposase orfA
gi|168789544 Escherichia coli O157:H7 str. EC869 NCBI   IS629 transposase orfA
gi|168789938 Escherichia coli O157:H7 str. EC869 NCBI   IS629 transposase orfA
gi|168790217 Escherichia coli O157:H7 str. EC869 NCBI   IS629 transposase orfA
gi|168790404 Escherichia coli O157:H7 str. EC869 NCBI   IS629 transposase orfA
gi|168797564 Escherichia coli O157:H7 str. EC508 NCBI   IS629 transposase orfA
gi|168797846 Escherichia coli O157:H7 str. EC508 NCBI   IS1203 transposase orfA
gi|168798415 Escherichia coli O157:H7 str. EC508 NCBI   IS629 transposase orfA
gi|168798541 Escherichia coli O157:H7 str. EC508 NCBI   IS1203 transposase orfA
gi|168800433 Escherichia coli O157:H7 str. EC508 NCBI   IS629 transposase orfA
gi|168800506 Escherichia coli O157:H7 str. EC508 NCBI   IS629 transposase orfA
gi|168800829 Escherichia coli O157:H7 str. EC508 NCBI   IS629 transposase orfA
gi|168801297 Escherichia coli O157:H7 str. EC508 NCBI   IS1203 transposase orfA
gi|168802141 Escherichia coli O157:H7 str. EC508 NCBI   IS629 transposase orfA
gi|168802612 Escherichia coli O157:H7 str. EC508 NCBI   IS1203 transposase orfA
gi|168802809 Escherichia coli O157:H7 str. EC508 NCBI   IS1203 transposase orfA
gi|168802965 Escherichia coli O157:H7 str. EC508 NCBI   IS629 transposase orfA
gi|17384567 Escherichia coli NCBI   orf327
gi|17977992 Bacteriophage CP-1639 NCBI   putative transposase
gi|17977997 Bacteriophage CP-1639 NCBI   putative transposase
gi|187767024 Escherichia coli O157:H7 str. EC4196 NCBI   IS1203 transposase orfA
gi|187767130 Escherichia coli O157:H7 str. EC4196 NCBI   IS629 transposase orfA
gi|187767307 Escherichia coli O157:H7 str. EC4196 NCBI   IS629 transposase orfA
gi|187767414 Escherichia coli O157:H7 str. EC4196 NCBI   IS1203 transposase orfA
gi|187767578 Escherichia coli O157:H7 str. EC4196 NCBI   IS629 transposase orfA
gi|187767937 Escherichia coli O157:H7 str. EC4196 NCBI   IS629 transposase orfA
gi|187768428 Escherichia coli O157:H7 str. EC4196 NCBI   IS629 transposase orfA
gi|187768576 Escherichia coli O157:H7 str. EC4196 NCBI   IS629 transposase orfA
gi|187768722 Escherichia coli O157:H7 str. EC4196 NCBI   IS629 transposase orfA
gi|187768944 Escherichia coli O157:H7 str. EC4196 NCBI   IS1203 transposase orfA
gi|187769032 Escherichia coli O157:H7 str. EC4196 NCBI   IS1203 transposase orfA
gi|187769573 Escherichia coli O157:H7 str. EC4196 NCBI   IS629 transposase orfA
gi|187770768 Escherichia coli O157:H7 str. EC4196 NCBI   IS629 transposase orfA
gi|187771229 Escherichia coli O157:H7 str. EC4196 NCBI   IS629 transposase orfA
gi|187771276 Escherichia coli O157:H7 str. EC4196 NCBI   IS629 transposase orfA
gi|188013608 Escherichia coli O157:H7 str. EC4113 NCBI   IS629 transposase orfA
gi|188013649 Escherichia coli O157:H7 str. EC4113 NCBI   IS629 transposase orfA
gi|188013748 Escherichia coli O157:H7 str. EC4113 NCBI   IS629 transposase orfA
gi|188014085 Escherichia coli O157:H7 str. EC4113 NCBI   IS629 transposase orfA
gi|188014347 Escherichia coli O157:H7 str. EC4113 NCBI   IS1203 transposase orfA
gi|188014415 Escherichia coli O157:H7 str. EC4113 NCBI   IS629 transposase orfA
gi|188014694 Escherichia coli O157:H7 str. EC4113 NCBI   IS1203 transposase orfA
gi|188015321 Escherichia coli O157:H7 str. EC4113 NCBI   IS1203 transposase orfA
gi|188015571 Escherichia coli O157:H7 str. EC4113 NCBI   IS1203 transposase orfA
gi|188015658 Escherichia coli O157:H7 str. EC4113 NCBI   IS629 transposase orfA
gi|188016085 Escherichia coli O157:H7 str. EC4113 NCBI   IS629 transposase orfA
gi|188016442 Escherichia coli O157:H7 str. EC4113 NCBI   IS1203 transposase orfA
gi|188017249 Escherichia coli O157:H7 str. EC4113 NCBI   IS629 transposase orfA
gi|188017851 Escherichia coli O157:H7 str. EC4113 NCBI   IS629 transposase orfA
gi|188998597 Escherichia coli O157:H7 str. EC4076 NCBI   IS629 transposase orfA
gi|188998750 Escherichia coli O157:H7 str. EC4076 NCBI   IS629 transposase orfA
gi|188998825 Escherichia coli O157:H7 str. EC4076 NCBI   IS629 transposase orfA
gi|188998867 Escherichia coli O157:H7 str. EC4076 NCBI   IS629 transposase orfA
gi|188999032 Escherichia coli O157:H7 str. EC4076 NCBI   IS1203 transposase orfA
gi|188999596 Escherichia coli O157:H7 str. EC4076 NCBI   IS629 transposase orfA
gi|188999879 Escherichia coli O157:H7 str. EC4076 NCBI   IS1203 transposase orfA
gi|189000185 Escherichia coli O157:H7 str. EC4076 NCBI   IS1203 transposase orfA
gi|189000511 Escherichia coli O157:H7 str. EC4076 NCBI   IS629 transposase orfA
gi|189001148 Escherichia coli O157:H7 str. EC4076 NCBI   IS1203 transposase orfA
gi|189001950 Escherichia coli O157:H7 str. EC4076 NCBI   IS629 transposase orfA
gi|189001968 Escherichia coli O157:H7 str. EC4076 NCBI   IS629 transposase orfA
gi|189003196 Escherichia coli O157:H7 str. EC4076 NCBI   IS629 transposase orfA
gi|189354680 Escherichia coli O157:H7 str. EC4401 NCBI   IS629 transposase orfA
gi|189354757 Escherichia coli O157:H7 str. EC4401 NCBI   IS629 transposase orfA
gi|189355330 Escherichia coli O157:H7 str. EC4401 NCBI   IS1203 transposase orfA
gi|189355491 Escherichia coli O157:H7 str. EC4401 NCBI   IS1203 transposase orfA
gi|189355687 Escherichia coli O157:H7 str. EC4401 NCBI   IS629 transposase orfA
gi|189356324 Escherichia coli O157:H7 str. EC4401 NCBI   IS629 transposase orfA
gi|189356969 Escherichia coli O157:H7 str. EC4401 NCBI   IS1203 transposase orfA
gi|189357291 Escherichia coli O157:H7 str. EC4401 NCBI   IS629 transposase orfA
gi|189357652 Escherichia coli O157:H7 str. EC4401 NCBI   IS629 transposase orfA
gi|189357689 Escherichia coli O157:H7 str. EC4401 NCBI   IS629 transposase orfA
gi|189358159 Escherichia coli O157:H7 str. EC4401 NCBI   IS1203 transposase orfA
gi|189358329 Escherichia coli O157:H7 str. EC4401 NCBI   IS1203 transposase orfA
gi|189358407 Escherichia coli O157:H7 str. EC4401 NCBI   IS629 transposase orfA
gi|189359699 Escherichia coli O157:H7 str. EC4486 NCBI   IS1203 transposase orfA
gi|189360159 Escherichia coli O157:H7 str. EC4486 NCBI   IS629 transposase orfA
gi|189360793 Escherichia coli O157:H7 str. EC4486 NCBI   IS629 transposase orfA
gi|189361236 Escherichia coli O157:H7 str. EC4486 NCBI   IS1203 transposase orfA
gi|189361364 Escherichia coli O157:H7 str. EC4486 NCBI   IS1203 transposase orfA
gi|189361699 Escherichia coli O157:H7 str. EC4486 NCBI   IS629 transposase orfA
gi|189361753 Escherichia coli O157:H7 str. EC4486 NCBI   IS629 transposase orfA
gi|189362122 Escherichia coli O157:H7 str. EC4486 NCBI   IS629 transposase orfA
gi|189362828 Escherichia coli O157:H7 str. EC4486 NCBI   IS629 transposase orfA
gi|189362841 Escherichia coli O157:H7 str. EC4486 NCBI   IS629 transposase orfA
gi|189363119 Escherichia coli O157:H7 str. EC4486 NCBI   IS1203 transposase orfA
gi|189363285 Escherichia coli O157:H7 str. EC4486 NCBI   IS1203 transposase orfA
gi|189363720 Escherichia coli O157:H7 str. EC4486 NCBI   IS629 transposase orfA
gi|189364844 Escherichia coli O157:H7 str. EC4501 NCBI   IS629 transposase orfA
gi|189365022 Escherichia coli O157:H7 str. EC4501 NCBI   IS629 transposase orfA
gi|189365050 Escherichia coli O157:H7 str. EC4501 NCBI   IS629 transposase orfA
gi|189365261 Escherichia coli O157:H7 str. EC4501 NCBI   IS1203 transposase orfA
gi|189366008 Escherichia coli O157:H7 str. EC4501 NCBI   IS629 transposase orfA
gi|189366587 Escherichia coli O157:H7 str. EC4501 NCBI   IS1203 transposase orfA
gi|189367020 Escherichia coli O157:H7 str. EC4501 NCBI   IS629 transposase orfA
gi|189367243 Escherichia coli O157:H7 str. EC4501 NCBI   IS629 transposase orfA
gi|189367558 Escherichia coli O157:H7 str. EC4501 NCBI   IS629 transposase orfA
gi|189367737 Escherichia coli O157:H7 str. EC4501 NCBI   IS629 transposase orfA
gi|189368290 Escherichia coli O157:H7 str. EC4501 NCBI   IS629 transposase orfA
gi|189369001 Escherichia coli O157:H7 str. EC4501 NCBI   IS1203 transposase orfA
gi|189369384 Escherichia coli O157:H7 str. EC4501 NCBI   IS629 transposase orfA
gi|189370117 Escherichia coli O157:H7 str. EC869 NCBI   IS629 transposase orfA
gi|189370281 Escherichia coli O157:H7 str. EC869 NCBI   IS629 transposase orfA
gi|189370517 Escherichia coli O157:H7 str. EC869 NCBI   IS629 transposase orfA
gi|189370858 Escherichia coli O157:H7 str. EC869 NCBI   IS629 transposase orfA
gi|189371022 Escherichia coli O157:H7 str. EC869 NCBI   IS629 transposase orfA
gi|189371509 Escherichia coli O157:H7 str. EC869 NCBI   IS1203 transposase orfA
gi|189372322 Escherichia coli O157:H7 str. EC869 NCBI   IS629 transposase orfA
gi|189372602 Escherichia coli O157:H7 str. EC869 NCBI   IS1203 transposase orfA
gi|189373778 Escherichia coli O157:H7 str. EC869 NCBI   IS629 transposase orfA
gi|189373924 Escherichia coli O157:H7 str. EC869 NCBI   IS629 transposase orfA
gi|189375235 Escherichia coli O157:H7 str. EC508 NCBI   IS629 transposase orfA
gi|189375300 Escherichia coli O157:H7 str. EC508 NCBI   IS1203 transposase orfA
gi|189375433 Escherichia coli O157:H7 str. EC508 NCBI   IS1203 transposase orfA
gi|189375822 Escherichia coli O157:H7 str. EC508 NCBI   IS629 transposase orfA
gi|189376547 Escherichia coli O157:H7 str. EC508 NCBI   IS1203 transposase orfA
gi|189376868 Escherichia coli O157:H7 str. EC508 NCBI   IS629 transposase orfA
gi|189377141 Escherichia coli O157:H7 str. EC508 NCBI   IS629 transposase orfA
gi|189377279 Escherichia coli O157:H7 str. EC508 NCBI   IS629 transposase orfA
gi|189378883 Escherichia coli O157:H7 str. EC508 NCBI   IS1203 transposase orfA
gi|189378957 Escherichia coli O157:H7 str. EC508 NCBI   IS629 transposase orfA
gi|189379470 Escherichia coli O157:H7 str. EC508 NCBI   IS1203 transposase orfA
gi|189379739 Escherichia coli O157:H7 str. EC508 NCBI   IS629 transposase orfA
gi|190900091 Escherichia coli B7A NCBI   IS629 transposase orfA
gi|191169868 Escherichia coli B7A NCBI   IS629 transposase orfA
gi|192955119 Escherichia coli E110019 NCBI   IS629 transposase orfA
gi|192955726 Escherichia coli E110019 NCBI   IS629 transposase orfA
gi|192957420 Escherichia coli E110019 NCBI   IS629 transposase orfA
gi|193069287 Escherichia coli E110019 NCBI   IS629 transposase orfA
gi|193070940 Escherichia coli E110019 NCBI   IS629 transposase orfA
gi|193071582 Escherichia coli E110019 NCBI   IS629 transposase orfA
gi|195935188 Escherichia coli O157:H7 str. EC4024 NCBI   putative transposase
gi|195935332 Escherichia coli O157:H7 str. EC4024 NCBI   putative transposase
gi|195935623 Escherichia coli O157:H7 str. EC4024 NCBI   putative transposase
gi|195935752 Escherichia coli O157:H7 str. EC4024 NCBI   putative transposase
gi|195937123 Escherichia coli O157:H7 str. EC4024 NCBI   putative transposase
gi|195937957 Escherichia coli O157:H7 str. EC4024 NCBI   putative transposase
gi|195938650 Escherichia coli O157:H7 str. EC4024 NCBI   putative transposase
gi|195938824 Escherichia coli O157:H7 str. EC4024 NCBI   putative transposase
gi|195938965 Escherichia coli O157:H7 str. EC4024 NCBI   putative transposase
gi|195939338 Escherichia coli O157:H7 str. EC4024 NCBI   putative transposase
gi|195939507 Escherichia coli O157:H7 str. EC4024 NCBI   putative transposase
gi|195939678 Escherichia coli O157:H7 str. EC4024 NCBI   putative transposase
gi|195939777 Escherichia coli O157:H7 str. EC4024 NCBI   putative transposase
gi|195940015 Escherichia coli O157:H7 str. EC4024 NCBI   putative transposase
gi|195940606 Escherichia coli O157:H7 str. EC4024 NCBI   putative transposase
gi|208724754 Escherichia coli O157:H7 str. EC4206 NCBI   IS629, transposase orfA
gi|208724945 Escherichia coli O157:H7 str. EC4206 NCBI   IS629, transposase orfA
gi|208725183 Escherichia coli O157:H7 str. EC4206 NCBI   IS629, transposase orfA
gi|208725541 Escherichia coli O157:H7 str. EC4206 NCBI   IS629, transposase orfA
gi|208725845 Escherichia coli O157:H7 str. EC4206 NCBI   IS629, transposase orfA
gi|208725884 Escherichia coli O157:H7 str. EC4206 NCBI   IS629, transposase orfA
gi|208726432 Escherichia coli O157:H7 str. EC4206 NCBI   IS629, transposase orfA
gi|208726616 Escherichia coli O157:H7 str. EC4206 NCBI   IS629, transposase orfA
gi|208726696 Escherichia coli O157:H7 str. EC4206 NCBI   IS629, transposase orfA
gi|208726859 Escherichia coli O157:H7 str. EC4206 NCBI   IS629, transposase orfA
gi|208727493 Escherichia coli O157:H7 str. EC4206 NCBI   IS629, transposase orfA
gi|208727592 Escherichia coli O157:H7 str. EC4206 NCBI   IS629, transposase orfA
gi|208728122 Escherichia coli O157:H7 str. EC4206 NCBI   IS629, transposase orfA
gi|208728756 Escherichia coli O157:H7 str. EC4206 NCBI   IS629, transposase orfA
gi|208729947 Escherichia coli O157:H7 str. EC4206 NCBI   IS629, transposase orfA
gi|208730627 Escherichia coli O157:H7 str. EC4045 NCBI   IS629, transposase orfA
gi|208730790 Escherichia coli O157:H7 str. EC4045 NCBI   IS629, transposase orfA
gi|208731115 Escherichia coli O157:H7 str. EC4045 NCBI   IS629, transposase orfA
gi|208731164 Escherichia coli O157:H7 str. EC4045 NCBI   IS629, transposase orfA
gi|208731178 Escherichia coli O157:H7 str. EC4045 NCBI   IS629, transposase orfA
gi|208731489 Escherichia coli O157:H7 str. EC4045 NCBI   IS629, transposase orfA
gi|208732766 Escherichia coli O157:H7 str. EC4045 NCBI   IS629, transposase orfA
gi|208733737 Escherichia coli O157:H7 str. EC4045 NCBI   IS629, transposase orfA
gi|208733793 Escherichia coli O157:H7 str. EC4045 NCBI   IS629, transposase orfA
gi|208734302 Escherichia coli O157:H7 str. EC4045 NCBI   IS629, transposase orfA
gi|208734355 Escherichia coli O157:H7 str. EC4045 NCBI   IS629, transposase orfA
gi|208734480 Escherichia coli O157:H7 str. EC4045 NCBI   IS629, transposase orfA
gi|208734719 Escherichia coli O157:H7 str. EC4045 NCBI   IS629, transposase orfA
gi|208735772 Escherichia coli O157:H7 str. EC4045 NCBI   IS629, transposase orfA
gi|208735799 Escherichia coli O157:H7 str. EC4045 NCBI   IS629, transposase orfA
gi|208736936 Escherichia coli O157:H7 str. EC4042 NCBI   IS629, transposase orfA
gi|208737223 Escherichia coli O157:H7 str. EC4042 NCBI   IS629, transposase orfA
gi|208737705 Escherichia coli O157:H7 str. EC4042 NCBI   IS629, transposase orfA
gi|208738679 Escherichia coli O157:H7 str. EC4042 NCBI   IS629, transposase orfA
gi|208738841 Escherichia coli O157:H7 str. EC4042 NCBI   IS629, transposase orfA
gi|208738941 Escherichia coli O157:H7 str. EC4042 NCBI   IS629, transposase orfA
gi|208739206 Escherichia coli O157:H7 str. EC4042 NCBI   IS629, transposase orfA
gi|208739445 Escherichia coli O157:H7 str. EC4042 NCBI   IS629, transposase orfA
gi|208739619 Escherichia coli O157:H7 str. EC4042 NCBI   IS629, transposase orfA
gi|208739706 Escherichia coli O157:H7 str. EC4042 NCBI   IS629, transposase orfA
gi|208740291 Escherichia coli O157:H7 str. EC4042 NCBI   IS629, transposase orfA
gi|208740465 Escherichia coli O157:H7 str. EC4042 NCBI   IS629, transposase orfA
gi|208740539 Escherichia coli O157:H7 str. EC4042 NCBI   IS629, transposase orfA
gi|208741685 Escherichia coli O157:H7 str. EC4042 NCBI   IS629, transposase orfA
gi|208741897 Escherichia coli O157:H7 str. EC4042 NCBI   IS629, transposase orfA
gi|208805740 Escherichia coli O157:H7 str. EC4206 NCBI   IS629, transposase orfA
gi|208806044 Escherichia coli O157:H7 str. EC4206 NCBI   IS629, transposase orfA
gi|208806083 Escherichia coli O157:H7 str. EC4206 NCBI   IS629, transposase orfA
gi|208806631 Escherichia coli O157:H7 str. EC4206 NCBI   IS629, transposase orfA
gi|208806815 Escherichia coli O157:H7 str. EC4206 NCBI   IS629, transposase orfA
gi|208806895 Escherichia coli O157:H7 str. EC4206 NCBI   IS629, transposase orfA
gi|208807058 Escherichia coli O157:H7 str. EC4206 NCBI   IS629, transposase orfA
gi|208807692 Escherichia coli O157:H7 str. EC4206 NCBI   IS629, transposase orfA
gi|208807791 Escherichia coli O157:H7 str. EC4206 NCBI   IS629, transposase orfA
gi|208808321 Escherichia coli O157:H7 str. EC4206 NCBI   IS629, transposase orfA
gi|208808955 Escherichia coli O157:H7 str. EC4206 NCBI   IS629, transposase orfA
gi|208810238 Escherichia coli O157:H7 str. EC4206 NCBI   IS629, transposase orfA
gi|208810429 Escherichia coli O157:H7 str. EC4206 NCBI   IS629, transposase orfA
gi|208810667 Escherichia coli O157:H7 str. EC4206 NCBI   IS629, transposase orfA
gi|208811317 Escherichia coli O157:H7 str. EC4206 NCBI   IS629, transposase orfA
gi|208812460 Escherichia coli O157:H7 str. EC4045 NCBI   IS629, transposase orfA
gi|208812516 Escherichia coli O157:H7 str. EC4045 NCBI   IS629, transposase orfA
gi|208813025 Escherichia coli O157:H7 str. EC4045 NCBI   IS629, transposase orfA
gi|208813078 Escherichia coli O157:H7 str. EC4045 NCBI   IS629, transposase orfA
gi|208813203 Escherichia coli O157:H7 str. EC4045 NCBI   IS629, transposase orfA
gi|208813442 Escherichia coli O157:H7 str. EC4045 NCBI   IS629, transposase orfA
gi|208814495 Escherichia coli O157:H7 str. EC4045 NCBI   IS629, transposase orfA
gi|208814522 Escherichia coli O157:H7 str. EC4045 NCBI   IS629, transposase orfA
gi|208814841 Escherichia coli O157:H7 str. EC4045 NCBI   IS629, transposase orfA
gi|208816118 Escherichia coli O157:H7 str. EC4045 NCBI   IS629, transposase orfA
gi|208816772 Escherichia coli O157:H7 str. EC4045 NCBI   IS629, transposase orfA
gi|208816821 Escherichia coli O157:H7 str. EC4045 NCBI   IS629, transposase orfA
gi|208816835 Escherichia coli O157:H7 str. EC4045 NCBI   IS629, transposase orfA
gi|208817171 Escherichia coli O157:H7 str. EC4045 NCBI   IS629, transposase orfA
gi|208817450 Escherichia coli O157:H7 str. EC4045 NCBI   IS629, transposase orfA
gi|208818556 Escherichia coli O157:H7 str. EC4042 NCBI   IS629, transposase orfA
gi|208818718 Escherichia coli O157:H7 str. EC4042 NCBI   IS629, transposase orfA
gi|208818818 Escherichia coli O157:H7 str. EC4042 NCBI   IS629, transposase orfA
gi|208819083 Escherichia coli O157:H7 str. EC4042 NCBI   IS629, transposase orfA
gi|208819322 Escherichia coli O157:H7 str. EC4042 NCBI   IS629, transposase orfA
gi|208819496 Escherichia coli O157:H7 str. EC4042 NCBI   IS629, transposase orfA
gi|208819583 Escherichia coli O157:H7 str. EC4042 NCBI   IS629, transposase orfA
gi|208820168 Escherichia coli O157:H7 str. EC4042 NCBI   IS629, transposase orfA
gi|208820342 Escherichia coli O157:H7 str. EC4042 NCBI   IS629, transposase orfA
gi|208820416 Escherichia coli O157:H7 str. EC4042 NCBI   IS629, transposase orfA
gi|208821562 Escherichia coli O157:H7 str. EC4042 NCBI   IS629, transposase orfA
gi|208821774 Escherichia coli O157:H7 str. EC4042 NCBI   IS629, transposase orfA
gi|208822220 Escherichia coli O157:H7 str. EC4042 NCBI   IS629, transposase orfA
gi|208823030 Escherichia coli O157:H7 str. EC4042 NCBI   IS629, transposase orfA
gi|208823341 Escherichia coli O157:H7 str. EC4042 NCBI   IS629, transposase orfA
gi|209157079 Escherichia coli O157:H7 str. EC4115 NCBI   IS629, transposase orfA
gi|209157141 Escherichia coli O157:H7 str. EC4115 NCBI   IS629, transposase orfA
gi|209157990 Escherichia coli O157:H7 str. EC4115 NCBI   IS629, transposase orfA
gi|209158183 Escherichia coli O157:H7 str. EC4115 NCBI   IS629, transposase orfA
gi|209158354 Escherichia coli O157:H7 str. EC4115 NCBI   IS629, transposase orfA
gi|209158958 Escherichia coli O157:H7 str. EC4115 NCBI   IS629, transposase orfA
gi|209159201 Escherichia coli O157:H7 str. EC4115 NCBI   IS629, transposase orfA
gi|209160016 Escherichia coli O157:H7 str. EC4115 NCBI   IS629, transposase orfA
gi|209160691 Escherichia coli O157:H7 str. EC4115 NCBI   IS629, transposase orfA
gi|209161213 Escherichia coli O157:H7 str. EC4115 NCBI   IS629, transposase orfA
gi|209161358 Escherichia coli O157:H7 str. EC4115 NCBI   IS629, transposase orfA
gi|209161640 Escherichia coli O157:H7 str. EC4115 NCBI   IS629, transposase orfA
gi|209161725 Escherichia coli O157:H7 str. EC4115 NCBI   IS629, transposase orfA
gi|209161831 Escherichia coli O157:H7 str. EC4115 NCBI   IS629, transposase orfA
gi|209361159 Stx2-converting phage 1717 NCBI   putative transposase
gi|209395624 Escherichia coli O157:H7 str. EC4115 NCBI   IS629, transposase orfA
gi|209395741 Escherichia coli O157:H7 str. EC4115 NCBI   IS629, transposase orfA
gi|209396590 Escherichia coli O157:H7 str. EC4115 NCBI   IS629, transposase orfA
gi|209396783 Escherichia coli O157:H7 str. EC4115 NCBI   IS629, transposase orfA
gi|209396954 Escherichia coli O157:H7 str. EC4115 NCBI   IS629, transposase orfA
gi|209397558 Escherichia coli O157:H7 str. EC4115 NCBI   IS629, transposase orfA
gi|209397801 Escherichia coli O157:H7 str. EC4115 NCBI   IS629, transposase orfA
gi|209398616 Escherichia coli O157:H7 str. EC4115 NCBI   IS629, transposase orfA
gi|209399291 Escherichia coli O157:H7 str. EC4115 NCBI   IS629, transposase orfA
gi|209399813 Escherichia coli O157:H7 str. EC4115 NCBI   IS629, transposase orfA
gi|209399958 Escherichia coli O157:H7 str. EC4115 NCBI   IS629, transposase orfA
gi|209400240 Escherichia coli O157:H7 str. EC4115 NCBI   IS629, transposase orfA
gi|209400325 Escherichia coli O157:H7 str. EC4115 NCBI   IS629, transposase orfA
gi|209400431 Escherichia coli O157:H7 str. EC4115 NCBI   IS629, transposase orfA
gi|209447180 Stx2-converting phage 1717 NCBI   putative transposase
gi|217317074 Escherichia coli O157:H7 str. TW14588 NCBI   IS629, transposase orfA
gi|217317223 Escherichia coli O157:H7 str. TW14588 NCBI   IS629, transposase orfA
gi|217317357 Escherichia coli O157:H7 str. TW14588 NCBI   IS629, transposase orfA
gi|217317758 Escherichia coli O157:H7 str. TW14588 NCBI   IS629, transposase orfA
gi|217318821 Escherichia coli O157:H7 str. TW14588 NCBI   IS629, transposase orfA
gi|217318859 Escherichia coli O157:H7 str. TW14588 NCBI   IS629, transposase orfA
gi|217319036 Escherichia coli O157:H7 str. TW14588 NCBI   IS629, transposase orfA
gi|217319558 Escherichia coli O157:H7 str. TW14588 NCBI   IS629, transposase orfA
gi|217319964 Escherichia coli O157:H7 str. TW14588 NCBI   IS629, transposase orfA
gi|217319986 Escherichia coli O157:H7 str. TW14588 NCBI   IS629, transposase orfA
gi|217321054 Escherichia coli O157:H7 str. TW14588 NCBI   IS629, transposase orfA
gi|217322442 Escherichia coli O157:H7 str. TW14588 NCBI   IS629, transposase orfA
gi|217322585 Escherichia coli O157:H7 str. TW14588 NCBI   IS629, transposase orfA
gi|217324833 Escherichia coli O157:H7 str. TW14588 NCBI   IS629, transposase orfA
gi|217326221 Escherichia coli O157:H7 str. TW14588 NCBI   IS629, transposase orfA
gi|217326364 Escherichia coli O157:H7 str. TW14588 NCBI   IS629, transposase orfA
gi|217326669 Escherichia coli O157:H7 str. TW14588 NCBI   IS629, transposase orfA
gi|217327191 Escherichia coli O157:H7 str. TW14588 NCBI   IS629, transposase orfA
gi|217327597 Escherichia coli O157:H7 str. TW14588 NCBI   IS629, transposase orfA
gi|217327619 Escherichia coli O157:H7 str. TW14588 NCBI   IS629, transposase orfA
gi|217328394 Escherichia coli O157:H7 str. TW14588 NCBI   IS629, transposase orfA
gi|217328432 Escherichia coli O157:H7 str. TW14588 NCBI   IS629, transposase orfA
gi|217329319 Escherichia coli O157:H7 str. TW14588 NCBI   IS629, transposase orfA
gi|217329589 Escherichia coli O157:H7 str. TW14588 NCBI   IS629, transposase orfA
gi|217329731 Escherichia coli O157:H7 str. TW14588 NCBI   IS629, transposase orfA
gi|217329843 Escherichia coli O157:H7 str. TW14588 NCBI   IS629, transposase orfA
gi|221361400 Escherichia coli NCBI   putative transposase
gi|221361446 Escherichia coli NCBI   putative insertion sequence related protein
gi|221361517 Escherichia coli NCBI   putative transposase
gi|221361564 Escherichia coli NCBI   putative transposase
gi|254590806 Escherichia coli O157:H7 str. TW14359 NCBI   Transposase
gi|254590821 Escherichia coli O157:H7 str. TW14359 NCBI   transposase
gi|254591598 Escherichia coli O157:H7 str. TW14359 NCBI   transposase
gi|254592594 Escherichia coli O157:H7 str. TW14359 NCBI   Transposase
gi|254593057 Escherichia coli O157:H7 str. TW14359 NCBI   Transposase
gi|254593101 Escherichia coli O157:H7 str. TW14359 NCBI   Transposase
gi|254593183 Escherichia coli O157:H7 str. TW14359 NCBI   Transposase
gi|254593343 Escherichia coli O157:H7 str. TW14359 NCBI   Transposase
gi|254593397 Escherichia coli O157:H7 str. TW14359 NCBI   Transposase
gi|254593540 Escherichia coli O157:H7 str. TW14359 NCBI   Transposase
gi|254593657 Escherichia coli O157:H7 str. TW14359 NCBI   Transposase
gi|254593973 Escherichia coli O157:H7 str. TW14359 NCBI   Transposase
gi|254594337 Escherichia coli O157:H7 str. TW14359 NCBI   Transposase
gi|254594613 Escherichia coli O157:H7 str. TW14359 NCBI   Transposase
gi|254595838 Escherichia coli O157:H7 str. TW14359 NCBI   hypothetical protein ECSP_6038
gi|254667486 Escherichia coli O157:H7 str. TW14359 NCBI   hypothetical protein ECSP_6038
gi|254791406 Escherichia coli O157:H7 str. TW14359 NCBI   Transposase
gi|254791421 Escherichia coli O157:H7 str. TW14359 NCBI   transposase
gi|254792198 Escherichia coli O157:H7 str. TW14359 NCBI   transposase
gi|254793194 Escherichia coli O157:H7 str. TW14359 NCBI   Transposase
gi|254793657 Escherichia coli O157:H7 str. TW14359 NCBI   Transposase
gi|254793701 Escherichia coli O157:H7 str. TW14359 NCBI   Transposase
gi|254793783 Escherichia coli O157:H7 str. TW14359 NCBI   Transposase
gi|254793943 Escherichia coli O157:H7 str. TW14359 NCBI   Transposase
gi|254793997 Escherichia coli O157:H7 str. TW14359 NCBI   Transposase
gi|254794140 Escherichia coli O157:H7 str. TW14359 NCBI   Transposase
gi|254794257 Escherichia coli O157:H7 str. TW14359 NCBI   Transposase
gi|254794573 Escherichia coli O157:H7 str. TW14359 NCBI   Transposase
gi|254794937 Escherichia coli O157:H7 str. TW14359 NCBI   Transposase
gi|254795213 Escherichia coli O157:H7 str. TW14359 NCBI   Transposase
gi|257752432 Escherichia coli O26:H11 str. 11368 NCBI   putative IS629 transposase OrfA
gi|257752672 Escherichia coli O26:H11 str. 11368 NCBI   putative IS629 transposase OrfA
gi|257752931 Escherichia coli O26:H11 str. 11368 NCBI   putative IS629 transposase OrfA
gi|257755755 Escherichia coli O26:H11 str. 11368 NCBI   putative IS629 transposase OrfA
gi|257756045 Escherichia coli O26:H11 str. 11368 NCBI   putative IS629 transposase OrfA
gi|257762800 Escherichia coli O111:H- str. 11128 NCBI   putative IS629 transposase OrfA
gi|257762809 Escherichia coli O111:H- str. 11128 NCBI   putative IS629 transposase OrfA
gi|257763060 Escherichia coli O111:H- str. 11128 NCBI   putative IS629 transposase OrfA
gi|257763254 Escherichia coli O111:H- str. 11128 NCBI   putative IS629 transposase OrfA
gi|257763500 Escherichia coli O111:H- str. 11128 NCBI   putative IS629 transposase OrfA
gi|257763535 Escherichia coli O111:H- str. 11128 NCBI   putative IS629 transposase OrfA
gi|257763670 Escherichia coli O111:H- str. 11128 NCBI   putative IS629 transposase OrfA
gi|257763742 Escherichia coli O111:H- str. 11128 NCBI   putative IS629 transposase OrfA
gi|257763865 Escherichia coli O111:H- str. 11128 NCBI   putative IS629 transposase OrfA
gi|257764012 Escherichia coli O111:H- str. 11128 NCBI   putative IS629 transposase OrfA
gi|257764033 Escherichia coli O111:H- str. 11128 NCBI   putative IS629 transposase OrfA
gi|257764153 Escherichia coli O111:H- str. 11128 NCBI   putative IS629 transposase OrfA
gi|257764349 Escherichia coli O111:H- str. 11128 NCBI   putative IS629 transposase OrfA
gi|257764561 Escherichia coli O111:H- str. 11128 NCBI   putative IS629 transposase OrfA
gi|257764668 Escherichia coli O111:H- str. 11128 NCBI   putative IS629 transposase OrfA
gi|257764985 Escherichia coli O111:H- str. 11128 NCBI   putative IS629 transposase OrfA
gi|257764989 Escherichia coli O111:H- str. 11128 NCBI   putative IS629 transposase OrfA
gi|257765001 Escherichia coli O111:H- str. 11128 NCBI   putative IS629 transposase OrfA
gi|257765016 Escherichia coli O111:H- str. 11128 NCBI   putative IS629 transposase OrfA
gi|257765034 Escherichia coli O111:H- str. 11128 NCBI   putative IS629 transposase OrfA
gi|257765036 Escherichia coli O111:H- str. 11128 NCBI   putative IS629 transposase OrfA
gi|257765671 Escherichia coli O111:H- str. 11128 NCBI   putative IS629 transposase OrfA
gi|257765690 Escherichia coli O111:H- str. 11128 NCBI   putative IS629 transposase OrfA
gi|257766014 Escherichia coli O111:H- str. 11128 NCBI   putative IS629 transposase OrfA
gi|257766064 Escherichia coli O111:H- str. 11128 NCBI   putative IS629 transposase OrfA
gi|257766281 Escherichia coli O111:H- str. 11128 NCBI   putative IS629 transposase OrfA
gi|257766586 Escherichia coli O111:H- str. 11128 NCBI   putative IS629 transposase OrfA
gi|257766768 Escherichia coli O111:H- str. 11128 NCBI   putative IS629 transposase OrfA
gi|257767238 Escherichia coli O111:H- str. 11128 NCBI   putative IS629 transposase OrfA
gi|257767318 Escherichia coli O111:H- str. 11128 NCBI   putative IS629 transposase OrfA
gi|257767395 Escherichia coli O111:H- str. 11128 NCBI   putative IS629 transposase OrfA
gi|257767420 Escherichia coli O111:H- str. 11128 NCBI   putative IS629 transposase OrfA
gi|257767507 Escherichia coli O111:H- str. 11128 NCBI   putative IS629 transposase OrfA
gi|257767517 Escherichia coli O111:H- str. 11128 NCBI   putative IS629 transposase OrfA
gi|257767628 Escherichia coli O111:H- str. 11128 NCBI   putative IS629 transposase OrfA
gi|257767790 Escherichia coli O111:H- str. 11128 NCBI   putative IS629 transposase OrfA
gi|257767821 Escherichia coli O111:H- str. 11128 NCBI   putative IS629 transposase OrfA
gi|257767851 Escherichia coli O111:H- str. 11128 NCBI   putative IS629 transposase OrfA
gi|257767884 Escherichia coli O111:H- str. 11128 NCBI   putative IS629 transposase OrfA
gi|32128332 Stx2 converting phage II NCBI   hypothetical protein
gi|32171154 Stx2 converting phage II NCBI   hypothetical protein Stx2IIp151
gi|3337029 Escherichia coli O157:H7 str. Sakai NCBI   IS629
gi|3721929 Escherichia coli NCBI   unnamed protein product
gi|3822180 Escherichia coli O157:H7 NCBI   hypothetical protein
gi|49523660 Phage BP-4795 NCBI   putative transposase OrfA protein of IS629
gi|51773724 Bacteriophage CP-1639 NCBI   unnamed protein product
gi|75994512 Escherichia coli O157:H7 EDL933 NCBI   hypothetical protein L7066
gi|7649867 Enterobacteria phage VT2-Sakai NCBI   hypothetical 12kD protein
gi|83308583 Escherichia coli NCBI   insertion element IS629 protein
gi|83404858 Escherichia coli NCBI   insertion element IS629 protein
img|637038875 Escherichia coli O157:H7 Sakai IMG   hypothetical protein
img|637063484 Escherichia coli O157:H7 EDL933 IMG   unknown in IS629
img|637063646 Escherichia coli O157:H7 EDL933 IMG   putative transposase encoded within prophage CP-933O
img|637063884 Escherichia coli O157:H7 EDL933 IMG   orf; hypothetical protein in IS629 within prophage CP-933R
img|637063928 Escherichia coli O157:H7 EDL933 IMG   unknown protein in IS629
img|637064543 Escherichia coli O157:H7 EDL933 IMG   unknown in IS629 encoded within prophage CP-933U
img|637064731 Escherichia coli O157:H7 EDL933 IMG   unknown protein in IS629
img|637065286 Escherichia coli O157:H7 EDL933 IMG   putative transposase
img|637065678 Escherichia coli O157:H7 EDL933 IMG   unknown protein in IS629
img|637065838 Escherichia coli O157:H7 EDL933 IMG   orf; hypothetical protein in IS629
img|637067061 Escherichia coli O157:H7 EDL933 IMG   orf; hypothetical protein in IS
img|637081739 Escherichia coli O157:H7 Sakai IMG   putative transposase
img|637081859 Escherichia coli O157:H7 Sakai IMG   putative transposase
img|637082305 Escherichia coli O157:H7 Sakai IMG   putative transposase
img|637082547 Escherichia coli O157:H7 Sakai IMG   putative transposase
img|637082854 Escherichia coli O157:H7 Sakai IMG   putative transposase
img|637083369 Escherichia coli O157:H7 Sakai IMG   putative transposase
img|637083749 Escherichia coli O157:H7 Sakai IMG   putative transposase
img|637084120 Escherichia coli O157:H7 Sakai IMG   putative transposase
img|637084485 Escherichia coli O157:H7 Sakai IMG   putative transposase
img|637084643 Escherichia coli O157:H7 Sakai IMG   putative transposase
img|637085911 Escherichia coli O157:H7 Sakai IMG   putative transposase
img|637720494 Escherichia coli O157:H7 EDL933 IMG   hypothetical protein
img|638300763 Stx2 converting bacteriophage II IMG   hypothetical protein
img|638670772 Escherichia coli E110019 IMG   COG2963: Transposase and inactivated derivatives
img|638672358 Escherichia coli E110019 IMG   COG2963: Transposase and inactivated derivatives
img|638672960 Escherichia coli E110019 IMG   COG2963: Transposase and inactivated derivatives
img|641215812 Escherichia coli JEF100 plasmid pCoo IMG   insertion element IS629 protein
img|642245874 Escherichia coli O157:H7 EC4206 IMG   IS629, transposase orfA
img|642245893 Escherichia coli O157:H7 EC4206 IMG   IS629, transposase orfA
img|642246133 Escherichia coli O157:H7 EC4206 IMG   IS629, transposase orfA
img|642246288 Escherichia coli O157:H7 EC4206 IMG   IS629, transposase orfA
img|642246416 Escherichia coli O157:H7 EC4206 IMG   IS629, transposase orfA
img|642246556 Escherichia coli O157:H7 EC4206 IMG   IS629, transposase orfA
img|642246871 Escherichia coli O157:H7 EC4206 IMG   IS629, transposase orfA
img|642247473 Escherichia coli O157:H7 EC4206 IMG   IS629, transposase orfA
img|642248275 Escherichia coli O157:H7 EC4206 IMG   IS629, transposase orfA
img|642248717 Escherichia coli O157:H7 EC4206 IMG   IS629, transposase orfA
img|642248880 Escherichia coli O157:H7 EC4206 IMG   IS629, transposase orfA
img|642249641 Escherichia coli O157:H7 EC4206 IMG   IS629, transposase orfA
img|642249821 Escherichia coli O157:H7 EC4206 IMG   IS629, transposase orfA
img|642250471 Escherichia coli O157:H7 EC4206 IMG   IS629, transposase orfA
img|642250564 Escherichia coli O157:H7 EC4206 IMG   IS629, transposase orfA
img|642251392 Escherichia coli O157:H7 EC4045 IMG   IS629, transposase orfA
img|642252286 Escherichia coli O157:H7 EC4045 IMG   IS629, transposase orfA
img|642253423 Escherichia coli O157:H7 EC4045 IMG   IS629, transposase orfA
img|642253469 Escherichia coli O157:H7 EC4045 IMG   IS629, transposase orfA
img|642253884 Escherichia coli O157:H7 EC4045 IMG   IS629, transposase orfA
img|642254205 Escherichia coli O157:H7 EC4045 IMG   IS629, transposase orfA
img|642255085 Escherichia coli O157:H7 EC4045 IMG   IS629, transposase orfA
img|642255219 Escherichia coli O157:H7 EC4045 IMG   IS629, transposase orfA
img|642255512 Escherichia coli O157:H7 EC4045 IMG   IS629, transposase orfA
img|642256741 Escherichia coli O157:H7 EC4045 IMG   IS629, transposase orfA
img|642256847 Escherichia coli O157:H7 EC4045 IMG   IS629, transposase orfA
img|642257026 Escherichia coli O157:H7 EC4045 IMG   IS629, transposase orfA
img|642257072 Escherichia coli O157:H7 EC4045 IMG   IS629, transposase orfA
img|642257132 Escherichia coli O157:H7 EC4045 IMG   IS629, transposase orfA
img|642257259 Escherichia coli O157:H7 EC4045 IMG   IS629, transposase orfA
img|642257640 Escherichia coli O157:H7 EC4045 IMG   IS629, transposase orfA
img|642258612 Escherichia coli O157:H7 EC4042 IMG   IS629, transposase orfA
img|642259026 Escherichia coli O157:H7 EC4042 IMG   IS629, transposase orfA
img|642259582 Escherichia coli O157:H7 EC4042 IMG   IS629, transposase orfA
img|642259632 Escherichia coli O157:H7 EC4042 IMG   IS629, transposase orfA
img|642259797 Escherichia coli O157:H7 EC4042 IMG   IS629, transposase orfA
img|642260933 Escherichia coli O157:H7 EC4042 IMG   IS629, transposase orfA
img|642261594 Escherichia coli O157:H7 EC4042 IMG   IS629, transposase orfA
img|642261765 Escherichia coli O157:H7 EC4042 IMG   IS629, transposase orfA
img|642262411 Escherichia coli O157:H7 EC4042 IMG   IS629, transposase orfA
img|642262543 Escherichia coli O157:H7 EC4042 IMG   IS629, transposase orfA
img|642262708 Escherichia coli O157:H7 EC4042 IMG   IS629, transposase orfA
img|642262879 Escherichia coli O157:H7 EC4042 IMG   IS629, transposase orfA
img|642263134 Escherichia coli O157:H7 EC4042 IMG   IS629, transposase orfA
img|642263286 Escherichia coli O157:H7 EC4042 IMG   IS629, transposase orfA
img|642263575 Escherichia coli O157:H7 EC4042 IMG   IS629, transposase orfA
img|642264155 Escherichia coli O157:H7 EC4115 IMG   IS629, transposase orfA
img|642264323 Escherichia coli O157:H7 EC4115 IMG   IS629, transposase orfA
img|642264458 Escherichia coli O157:H7 EC4115 IMG   IS629, transposase orfA
img|642264835 Escherichia coli O157:H7 EC4115 IMG   IS629, transposase orfA
img|642266851 Escherichia coli O157:H7 EC4115 IMG   IS629, transposase orfA
img|642266862 Escherichia coli O157:H7 EC4115 IMG   IS629, transposase orfA
img|642268373 Escherichia coli O157:H7 EC4115 IMG   IS629, transposase orfA
img|642268969 Escherichia coli O157:H7 EC4115 IMG   IS629, transposase orfA
img|642269066 Escherichia coli O157:H7 EC4115 IMG   IS629, transposase orfA
img|642269215 Escherichia coli O157:H7 EC4115 IMG   IS629, transposase orfA
img|642269372 Escherichia coli O157:H7 EC4115 IMG   IS629, transposase orfA
img|642269530 Escherichia coli O157:H7 EC4115 IMG   IS629, transposase orfA
img|642269698 Escherichia coli O157:H7 EC4115 IMG   IS629, transposase orfA
img|642269935 Escherichia coli O157:H7 EC4115 IMG   IS629, transposase orfA
img|642271117 Escherichia coli O157:H7 EC4196 IMG   IS629, transposase orfA
img|642271254 Escherichia coli O157:H7 EC4196 IMG   IS629, transposase orfA
img|642271600 Escherichia coli O157:H7 EC4196 IMG   IS629, transposase orfA
img|642273093 Escherichia coli O157:H7 EC4196 IMG   IS629, transposase orfA
img|642273699 Escherichia coli O157:H7 EC4196 IMG   IS629, transposase orfA
img|642273810 Escherichia coli O157:H7 EC4196 IMG   IS629, transposase orfA
img|642274068 Escherichia coli O157:H7 EC4196 IMG   IS629, transposase orfA
img|642274195 Escherichia coli O157:H7 EC4196 IMG   IS629, transposase orfA
img|642274381 Escherichia coli O157:H7 EC4196 IMG   IS629, transposase orfA
img|642275005 Escherichia coli O157:H7 EC4196 IMG   IS629, transposase orfA
img|642275406 Escherichia coli O157:H7 EC4196 IMG   IS629, transposase orfA
img|642275607 Escherichia coli O157:H7 EC4196 IMG   IS629, transposase orfA
img|642275768 Escherichia coli O157:H7 EC4196 IMG   IS629, transposase orfA
img|642275987 Escherichia coli O157:H7 EC4196 IMG   IS629, transposase orfA
img|642276135 Escherichia coli O157:H7 EC4196 IMG   IS629, transposase orfA
img|642276661 Escherichia coli O157:H7 EC4196 IMG   IS629, transposase orfA
img|642277407 Escherichia coli O157:H7 EC4113 IMG   IS629, transposase orfA
img|642278125 Escherichia coli O157:H7 EC4113 IMG   IS629, transposase orfA
img|642279005 Escherichia coli O157:H7 EC4113 IMG   IS629, transposase orfA
img|642279560 Escherichia coli O157:H7 EC4113 IMG   IS629, transposase orfA
img|642280015 Escherichia coli O157:H7 EC4113 IMG   IS629, transposase orfA
img|642280143 Escherichia coli O157:H7 EC4113 IMG   IS629, transposase orfA
img|642280398 Escherichia coli O157:H7 EC4113 IMG   IS629, transposase orfA
img|642281179 Escherichia coli O157:H7 EC4113 IMG   IS629, transposase orfA
img|642281498 Escherichia coli O157:H7 EC4113 IMG   IS629, transposase orfA
img|642281621 Escherichia coli O157:H7 EC4113 IMG   IS629, transposase orfA
img|642281893 Escherichia coli O157:H7 EC4113 IMG   IS629, transposase orfA
img|642282367 Escherichia coli O157:H7 EC4113 IMG   IS629, transposase orfA
img|642282489 Escherichia coli O157:H7 EC4113 IMG   IS629, transposase orfA
img|642282571 Escherichia coli O157:H7 EC4113 IMG   IS629, transposase orfA
img|642283039 Escherichia coli O157:H7 EC4113 IMG   IS629, transposase orfA
img|642283297 Escherichia coli O157:H7 EC4076 IMG   IS629, transposase orfA
img|642284820 Escherichia coli O157:H7 EC4076 IMG   IS629, transposase orfA
img|642284957 Escherichia coli O157:H7 EC4076 IMG   IS629, transposase orfA
img|642285706 Escherichia coli O157:H7 EC4076 IMG   IS629, transposase orfA
img|642286614 Escherichia coli O157:H7 EC4076 IMG   IS629, transposase orfA
img|642287044 Escherichia coli O157:H7 EC4076 IMG   IS629, transposase orfA
img|642287373 Escherichia coli O157:H7 EC4076 IMG   IS629, transposase orfA
img|642287787 Escherichia coli O157:H7 EC4076 IMG   IS629, transposase orfA
img|642288453 Escherichia coli O157:H7 EC4076 IMG   IS629, transposase orfA
img|642288629 Escherichia coli O157:H7 EC4076 IMG   IS629, transposase orfA
img|642288687 Escherichia coli O157:H7 EC4076 IMG   IS629, transposase orfA
img|642288783 Escherichia coli O157:H7 EC4076 IMG   IS629, transposase orfA
img|642288983 Escherichia coli O157:H7 EC4076 IMG   IS629, transposase orfA
img|642289344 Escherichia coli O157:H7 EC4076 IMG   IS629, transposase orfA
img|642290315 Escherichia coli O157:H7 EC4401 IMG   IS629, transposase orfA
img|642290629 Escherichia coli O157:H7 EC4401 IMG   IS629, transposase orfA
img|642290841 Escherichia coli O157:H7 EC4401 IMG   IS629, transposase orfA
img|642291382 Escherichia coli O157:H7 EC4401 IMG   IS629, transposase orfA
img|642291517 Escherichia coli O157:H7 EC4401 IMG   IS629, transposase orfA
img|642291764 Escherichia coli O157:H7 EC4401 IMG   IS629, transposase orfA
img|642292212 Escherichia coli O157:H7 EC4401 IMG   IS629, transposase orfA
img|642292888 Escherichia coli O157:H7 EC4401 IMG   IS629, transposase orfA
img|642293703 Escherichia coli O157:H7 EC4401 IMG   IS629, transposase orfA
img|642293949 Escherichia coli O157:H7 EC4401 IMG   IS629, transposase orfA
img|642294086 Escherichia coli O157:H7 EC4401 IMG   IS629, transposase orfA
img|642294857 Escherichia coli O157:H7 EC4401 IMG   IS629, transposase orfA
img|642294933 Escherichia coli O157:H7 EC4401 IMG   IS629, transposase orfA
img|642297173 Escherichia coli O157:H7 EC4486 IMG   IS629, transposase orfA
img|642297622 Escherichia coli O157:H7 EC4486 IMG   IS629, transposase orfA
img|642297833 Escherichia coli O157:H7 EC4486 IMG   IS629, transposase orfA
img|642298068 Escherichia coli O157:H7 EC4486 IMG   IS629, transposase orfA
img|642298203 Escherichia coli O157:H7 EC4486 IMG   IS629, transposase orfA
img|642298935 Escherichia coli O157:H7 EC4486 IMG   IS629, transposase orfA
img|642299366 Escherichia coli O157:H7 EC4486 IMG   IS629, transposase orfA
img|642299476 Escherichia coli O157:H7 EC4486 IMG   IS629, transposase orfA
img|642299847 Escherichia coli O157:H7 EC4486 IMG   IS629, transposase orfA
img|642299986 Escherichia coli O157:H7 EC4486 IMG   IS629, transposase orfA
img|642300566 Escherichia coli O157:H7 EC4486 IMG   IS629, transposase orfA
img|642301273 Escherichia coli O157:H7 EC4486 IMG   IS629, transposase orfA
img|642301833 Escherichia coli O157:H7 EC4486 IMG   IS629, transposase orfA
img|642303267 Escherichia coli O157:H7 EC4501 IMG   IS629, transposase orfA
img|642303658 Escherichia coli O157:H7 EC4501 IMG   IS629, transposase orfA
img|642304458 Escherichia coli O157:H7 EC4501 IMG   IS629, transposase orfA
img|642305043 Escherichia coli O157:H7 EC4501 IMG   IS629, transposase orfA
img|642305250 Escherichia coli O157:H7 EC4501 IMG   IS629, transposase orfA
img|642305570 Escherichia coli O157:H7 EC4501 IMG   IS629, transposase orfA
img|642305800 Escherichia coli O157:H7 EC4501 IMG   IS629, transposase orfA
img|642306320 Escherichia coli O157:H7 EC4501 IMG   IS629, transposase orfA
img|642307044 Escherichia coli O157:H7 EC4501 IMG   IS629, transposase orfA
img|642307967 Escherichia coli O157:H7 EC4501 IMG   IS629, transposase orfA
img|642308271 Escherichia coli O157:H7 EC4501 IMG   IS629, transposase orfA
img|642308324 Escherichia coli O157:H7 EC4501 IMG   IS629, transposase orfA
img|642308701 Escherichia coli O157:H7 EC4501 IMG   IS629, transposase orfA
img|642308851 Escherichia coli O157:H7 EC4501 IMG   IS629, transposase orfA
img|642310193 Escherichia coli O157:H7 EC869 IMG   IS629, transposase orfA
img|642310374 Escherichia coli O157:H7 EC869 IMG   IS629, transposase orfA
img|642311836 Escherichia coli O157:H7 EC869 IMG   IS629, transposase orfA
img|642312308 Escherichia coli O157:H7 EC869 IMG   IS629, transposase orfA
img|642313232 Escherichia coli O157:H7 EC869 IMG   IS629, transposase orfA
img|642313784 Escherichia coli O157:H7 EC869 IMG   IS629, transposase orfA
img|642313966 Escherichia coli O157:H7 EC869 IMG   IS629, transposase orfA
img|642314366 Escherichia coli O157:H7 EC869 IMG   IS629, transposase orfA
img|642314646 Escherichia coli O157:H7 EC869 IMG   IS629, transposase orfA
img|642314842 Escherichia coli O157:H7 EC869 IMG   IS629, transposase orfA
img|642315756 Escherichia coli O157:H7 EC508 IMG   IS629, transposase orfA
img|642316042 Escherichia coli O157:H7 EC508 IMG   IS629, transposase orfA
img|642316617 Escherichia coli O157:H7 EC508 IMG   IS629, transposase orfA
img|642316743 Escherichia coli O157:H7 EC508 IMG   IS629, transposase orfA
img|642318650 Escherichia coli O157:H7 EC508 IMG   IS629, transposase orfA
img|642318723 Escherichia coli O157:H7 EC508 IMG   IS629, transposase orfA
img|642319057 Escherichia coli O157:H7 EC508 IMG   IS629, transposase orfA
img|642319533 Escherichia coli O157:H7 EC508 IMG   IS629, transposase orfA
img|642320394 Escherichia coli O157:H7 EC508 IMG   IS629, transposase orfA
img|642320872 Escherichia coli O157:H7 EC508 IMG   IS629, transposase orfA
img|642321077 Escherichia coli O157:H7 EC508 IMG   IS629, transposase orfA
img|642321236 Escherichia coli O157:H7 EC508 IMG   IS629, transposase orfA
img|642321493 Escherichia coli O157:H7 EC508 IMG   IS629, transposase orfA
img|642481875 Escherichia coli plasmid MccC7-H22 IMG   putative transposase OrfA
img|642813448 Escherichia coli O157:H7 EC4024 IMG   putative transposase
img|642813593 Escherichia coli O157:H7 EC4024 IMG   putative transposase
img|642813886 Escherichia coli O157:H7 EC4024 IMG   putative transposase
img|642814015 Escherichia coli O157:H7 EC4024 IMG   putative transposase
img|642815413 Escherichia coli O157:H7 EC4024 IMG   putative transposase
img|642816254 Escherichia coli O157:H7 EC4024 IMG   putative transposase
img|642816975 Escherichia coli O157:H7 EC4024 IMG   putative transposase
img|642817156 Escherichia coli O157:H7 EC4024 IMG   putative transposase
img|642817297 Escherichia coli O157:H7 EC4024 IMG   putative transposase
img|642817676 Escherichia coli O157:H7 EC4024 IMG   putative transposase
img|642817853 Escherichia coli O157:H7 EC4024 IMG   putative transposase
img|642818029 Escherichia coli O157:H7 EC4024 IMG   putative transposase
img|642818128 Escherichia coli O157:H7 EC4024 IMG   putative transposase
img|642818372 Escherichia coli O157:H7 EC4024 IMG   putative transposase
img|642818977 Escherichia coli O157:H7 EC4024 IMG   putative transposase
kegg|ece:L7066 Escherichia coli O157:H7 EDL933 (EHEC) KEGG   hypothetical protein
kegg|ece:Z1933 Escherichia coli O157:H7 EDL933 (EHEC) KEGG   unknown in IS629
kegg|ece:Z2110 Escherichia coli O157:H7 EDL933 (EHEC) KEGG   putative transposase encoded within prophage CP-933O
kegg|ece:Z2375 Escherichia coli O157:H7 EDL933 (EHEC) KEGG   hypothetical protein
kegg|ece:Z2429 Escherichia coli O157:H7 EDL933 (EHEC) KEGG   unknown protein in IS629
kegg|ece:Z3093 Escherichia coli O157:H7 EDL933 (EHEC) KEGG   unknown in IS629 encoded within prophage CP-933U
kegg|ece:Z3299 Escherichia coli O157:H7 EDL933 (EHEC) KEGG   unknown protein in IS629
kegg|ece:Z3922 Escherichia coli O157:H7 EDL933 (EHEC) KEGG   putative transposase
kegg|ece:Z4335 Escherichia coli O157:H7 EDL933 (EHEC) KEGG   unknown protein in IS629
kegg|ece:Z4502 Escherichia coli O157:H7 EDL933 (EHEC) KEGG   hypothetical protein
kegg|ece:Z5879 Escherichia coli O157:H7 EDL933 (EHEC) KEGG   hypothetical protein
kegg|ecf:ECH74115_0292 Escherichia coli O157:H7 EC4115 (EHEC) KEGG   IS629, transposase orfA
kegg|ecf:ECH74115_1169 Escherichia coli O157:H7 EC4115 (EHEC) KEGG   IS629, transposase orfA
kegg|ecf:ECH74115_1177 Escherichia coli O157:H7 EC4115 (EHEC) KEGG   IS629, transposase orfA
kegg|ecf:ECH74115_1656 Escherichia coli O157:H7 EC4115 (EHEC) KEGG   IS629, transposase orfA
kegg|ecf:ECH74115_2285 Escherichia coli O157:H7 EC4115 (EHEC) KEGG   IS629, transposase orfA
kegg|ecf:ECH74115_2788 Escherichia coli O157:H7 EC4115 (EHEC) KEGG   IS629, transposase orfA
kegg|ecf:ECH74115_2844 Escherichia coli O157:H7 EC4115 (EHEC) KEGG   IS629, transposase orfA
kegg|ecf:ECH74115_2933 Escherichia coli O157:H7 EC4115 (EHEC) KEGG   IS629, transposase orfA
kegg|ecf:ECH74115_3231 Escherichia coli O157:H7 EC4115 (EHEC) KEGG   IS629, transposase orfA
kegg|ecf:ECH74115_3385 Escherichia coli O157:H7 EC4115 (EHEC) KEGG   IS629, transposase orfA
kegg|ecf:ECH74115_3515 Escherichia coli O157:H7 EC4115 (EHEC) KEGG   IS629, transposase orfA
kegg|ecf:ECH74115_3873 Escherichia coli O157:H7 EC4115 (EHEC) KEGG   IS629, transposase orfA
kegg|ecf:ECH74115_4590 Escherichia coli O157:H7 EC4115 (EHEC) KEGG   IS629, transposase orfA
kegg|ecf:ECH74115_B0042 Escherichia coli O157:H7 EC4115 (EHEC) KEGG   IS629, transposase orfA
kegg|ecs:ECs1089 Escherichia coli O157:H7 Sakai (EHEC) KEGG   putative transposase
kegg|ecs:ECs1209 Escherichia coli O157:H7 Sakai (EHEC) KEGG   putative transposase
kegg|ecs:ECs1665 Escherichia coli O157:H7 Sakai (EHEC) KEGG   putative transposase
kegg|ecs:ECs1919 Escherichia coli O157:H7 Sakai (EHEC) KEGG   putative transposase
kegg|ecs:ECs2220 Escherichia coli O157:H7 Sakai (EHEC) KEGG   putative transposase
kegg|ecs:ECs2744 Escherichia coli O157:H7 Sakai (EHEC) KEGG   putative transposase
kegg|ecs:ECs3132 Escherichia coli O157:H7 Sakai (EHEC) KEGG   putative transposase
kegg|ecs:ECs3490 Escherichia coli O157:H7 Sakai (EHEC) KEGG   putative transposase
kegg|ecs:ECs3863 Escherichia coli O157:H7 Sakai (EHEC) KEGG   putative transposase
kegg|ecs:ECs4024 Escherichia coli O157:H7 Sakai (EHEC) KEGG   putative transposase
kegg|ecs:ECs5243 Escherichia coli O157:H7 Sakai (EHEC) KEGG   putative transposase
kegg|ecs:pO157p83 Escherichia coli O157:H7 Sakai (EHEC) KEGG   hypothetical protein
kegg|etw:ECSP_0281 Escherichia coli O157:H7 TW14359 (EHEC) KEGG   transposase
kegg|etw:ECSP_0297 Escherichia coli O157:H7 TW14359 (EHEC) KEGG   transposase
kegg|etw:ECSP_1107 Escherichia coli O157:H7 TW14359 (EHEC) KEGG   transposase
kegg|etw:ECSP_2141 Escherichia coli O157:H7 TW14359 (EHEC) KEGG   transposase
kegg|etw:ECSP_2612 Escherichia coli O157:H7 TW14359 (EHEC) KEGG   transposase
kegg|etw:ECSP_2664 Escherichia coli O157:H7 TW14359 (EHEC) KEGG   transposase
kegg|etw:ECSP_2750 Escherichia coli O157:H7 TW14359 (EHEC) KEGG   transposase
kegg|etw:ECSP_2915 Escherichia coli O157:H7 TW14359 (EHEC) KEGG   transposase
kegg|etw:ECSP_2975 Escherichia coli O157:H7 TW14359 (EHEC) KEGG   transposase
kegg|etw:ECSP_3122 Escherichia coli O157:H7 TW14359 (EHEC) KEGG   transposase
kegg|etw:ECSP_3239 Escherichia coli O157:H7 TW14359 (EHEC) KEGG   transposase
kegg|etw:ECSP_3572 Escherichia coli O157:H7 TW14359 (EHEC) KEGG   transposase
kegg|etw:ECSP_3959 Escherichia coli O157:H7 TW14359 (EHEC) KEGG   transposase
kegg|etw:ECSP_4240 Escherichia coli O157:H7 TW14359 (EHEC) KEGG   transposase
kegg|etw:ECSP_6038 Escherichia coli O157:H7 TW14359 (EHEC) KEGG   hypothetical protein
ref|NP_052638.1 Escherichia coli O157:H7 str. Sakai RefSeq   hypothetical protein pO157p83
ref|NP_287410.1 Escherichia coli O157:H7 EDL933 RefSeq   unknown in IS629
ref|NP_287568.1 Escherichia coli O157:H7 EDL933 RefSeq   putative transposase encoded within prophage CP-933O
ref|NP_287806.1 Escherichia coli O157:H7 EDL933 RefSeq   hypothetical protein Z2375
ref|NP_287848.1 Escherichia coli O157:H7 EDL933 RefSeq   unknown protein in IS629
ref|NP_288455.1 Escherichia coli O157:H7 EDL933 RefSeq   unknown in IS629 encoded within prophage CP-933U
ref|NP_288635.1 Escherichia coli O157:H7 EDL933 RefSeq   unknown protein in IS629
ref|NP_289179.1 Escherichia coli O157:H7 EDL933 RefSeq   putative transposase
ref|NP_289560.1 Escherichia coli O157:H7 EDL933 RefSeq   unknown protein in IS629
ref|NP_289719.1 Escherichia coli O157:H7 EDL933 RefSeq   hypothetical protein Z4502
ref|NP_290899.1 Escherichia coli O157:H7 EDL933 RefSeq   hypothetical protein Z5879
ref|NP_309116.1 Escherichia coli O157:H7 str. Sakai RefSeq   putative transposase
ref|NP_309236.1 Escherichia coli O157:H7 str. Sakai RefSeq   putative transposase
ref|NP_309692.1 Escherichia coli O157:H7 str. Sakai RefSeq   putative transposase
ref|NP_309946.1 Escherichia coli O157:H7 str. Sakai RefSeq   putative transposase
ref|NP_310247.1 Escherichia coli O157:H7 str. Sakai RefSeq   putative transposase
ref|NP_310771.1 Escherichia coli O157:H7 str. Sakai RefSeq   putative transposase
ref|NP_311159.1 Escherichia coli O157:H7 str. Sakai RefSeq   putative transposase
ref|NP_311517.1 Escherichia coli O157:H7 str. Sakai RefSeq   putative transposase
ref|NP_311890.1 Escherichia coli O157:H7 str. Sakai RefSeq   putative transposase
ref|NP_312051.1 Escherichia coli O157:H7 str. Sakai RefSeq   putative transposase
ref|NP_313270.1 Escherichia coli O157:H7 str. Sakai RefSeq   putative transposase
ref|NP_859398.1 Stx2 converting phage II RefSeq   hypothetical protein Stx2IIp151
ref|YP_001449314.1 Phage BP-4795 RefSeq   putative transposase OrfA protein of IS629
ref|YP_001649259.1 Escherichia coli RefSeq   putative transposase OrfA
ref|YP_002268425.1 Escherichia coli O157:H7 str. EC4115 RefSeq   IS629, transposase orfA
ref|YP_002268873.1 Escherichia coli O157:H7 str. EC4115 RefSeq   IS629, transposase orfA
ref|YP_002269664.1 Escherichia coli O157:H7 str. EC4115 RefSeq   IS629, transposase orfA
ref|YP_002269672.1 Escherichia coli O157:H7 str. EC4115 RefSeq   IS629, transposase orfA
ref|YP_002270110.1 Escherichia coli O157:H7 str. EC4115 RefSeq   IS629, transposase orfA
ref|YP_002270648.1 Escherichia coli O157:H7 str. EC4115 RefSeq   IS629, transposase orfA
ref|YP_002271120.1 Escherichia coli O157:H7 str. EC4115 RefSeq   IS629, transposase orfA
ref|YP_002271163.1 Escherichia coli O157:H7 str. EC4115 RefSeq   IS629, transposase orfA
ref|YP_002271245.1 Escherichia coli O157:H7 str. EC4115 RefSeq   IS629, transposase orfA
ref|YP_002271512.1 Escherichia coli O157:H7 str. EC4115 RefSeq   IS629, transposase orfA
ref|YP_002271656.1 Escherichia coli O157:H7 str. EC4115 RefSeq   IS629, transposase orfA
ref|YP_002271779.1 Escherichia coli O157:H7 str. EC4115 RefSeq   IS629, transposase orfA
ref|YP_002272100.1 Escherichia coli O157:H7 str. EC4115 RefSeq   IS629, transposase orfA
ref|YP_002272733.1 Escherichia coli O157:H7 str. EC4115 RefSeq   IS629, transposase orfA
ref|YP_002274265.1 Stx2-converting phage 1717 RefSeq   putative transposase
ref|YP_003076243.1 Escherichia coli O157:H7 str. TW14359 RefSeq   Transposase
ref|YP_003076258.1 Escherichia coli O157:H7 str. TW14359 RefSeq   transposase
ref|YP_003077035.1 Escherichia coli O157:H7 str. TW14359 RefSeq   transposase
ref|YP_003078031.1 Escherichia coli O157:H7 str. TW14359 RefSeq   Transposase
ref|YP_003078494.1 Escherichia coli O157:H7 str. TW14359 RefSeq   Transposase
ref|YP_003078538.1 Escherichia coli O157:H7 str. TW14359 RefSeq   Transposase
ref|YP_003078620.1 Escherichia coli O157:H7 str. TW14359 RefSeq   Transposase
ref|YP_003078780.1 Escherichia coli O157:H7 str. TW14359 RefSeq   Transposase
ref|YP_003078834.1 Escherichia coli O157:H7 str. TW14359 RefSeq   Transposase
ref|YP_003078977.1 Escherichia coli O157:H7 str. TW14359 RefSeq   Transposase
ref|YP_003079094.1 Escherichia coli O157:H7 str. TW14359 RefSeq   Transposase
ref|YP_003079410.1 Escherichia coli O157:H7 str. TW14359 RefSeq   Transposase
ref|YP_003079774.1 Escherichia coli O157:H7 str. TW14359 RefSeq   Transposase
ref|YP_003080050.1 Escherichia coli O157:H7 str. TW14359 RefSeq   Transposase
ref|YP_003082172.1 Escherichia coli O157:H7 str. TW14359 RefSeq   hypothetical protein ECSP_6038
ref|YP_325626.1 Escherichia coli O157:H7 EDL933 RefSeq   hypothetical protein L7066
ref|YP_424872.1 Escherichia coli RefSeq   insertion element IS629 protein
ref|ZP_02772541.1 Escherichia coli O157:H7 str. EC4113 RefSeq   IS629 transposase orfA
ref|ZP_02773252.1 Escherichia coli O157:H7 str. EC4113 RefSeq   IS629 transposase orfA
ref|ZP_02774127.1 Escherichia coli O157:H7 str. EC4113 RefSeq   IS1203 transposase orfA
ref|ZP_02774676.1 Escherichia coli O157:H7 str. EC4113 RefSeq   IS629 transposase orfA
ref|ZP_02775131.1 Escherichia coli O157:H7 str. EC4113 RefSeq   IS629 transposase orfA
ref|ZP_02775254.1 Escherichia coli O157:H7 str. EC4113 RefSeq   IS1203 transposase orfA
ref|ZP_02775492.1 Escherichia coli O157:H7 str. EC4113 RefSeq   IS1203 transposase orfA
ref|ZP_02776261.1 Escherichia coli O157:H7 str. EC4113 RefSeq   IS1203 transposase orfA
ref|ZP_02776575.1 Escherichia coli O157:H7 str. EC4113 RefSeq   IS629 transposase orfA
ref|ZP_02776698.1 Escherichia coli O157:H7 str. EC4113 RefSeq   IS1203 transposase orfA
ref|ZP_02776961.1 Escherichia coli O157:H7 str. EC4113 RefSeq   IS629 transposase orfA
ref|ZP_02777413.1 Escherichia coli O157:H7 str. EC4113 RefSeq   IS629 transposase orfA
ref|ZP_02777531.1 Escherichia coli O157:H7 str. EC4113 RefSeq   IS629 transposase orfA
ref|ZP_02777610.1 Escherichia coli O157:H7 str. EC4113 RefSeq   IS629 transposase orfA
ref|ZP_02778948.1 Escherichia coli O157:H7 str. EC4401 RefSeq   IS629 transposase orfA
ref|ZP_02779256.1 Escherichia coli O157:H7 str. EC4401 RefSeq   IS1203 transposase orfA
ref|ZP_02779467.1 Escherichia coli O157:H7 str. EC4401 RefSeq   IS1203 transposase orfA
ref|ZP_02780004.1 Escherichia coli O157:H7 str. EC4401 RefSeq   IS629 transposase orfA
ref|ZP_02780139.1 Escherichia coli O157:H7 str. EC4401 RefSeq   IS629 transposase orfA
ref|ZP_02780377.1 Escherichia coli O157:H7 str. EC4401 RefSeq   IS629 transposase orfA
ref|ZP_02780814.1 Escherichia coli O157:H7 str. EC4401 RefSeq   IS1203 transposase orfA
ref|ZP_02781489.1 Escherichia coli O157:H7 str. EC4401 RefSeq   IS629 transposase orfA
ref|ZP_02782302.1 Escherichia coli O157:H7 str. EC4401 RefSeq   IS629 transposase orfA
ref|ZP_02782547.1 Escherichia coli O157:H7 str. EC4401 RefSeq   IS1203 transposase orfA
ref|ZP_02782679.1 Escherichia coli O157:H7 str. EC4401 RefSeq   IS1203 transposase orfA
ref|ZP_02783434.1 Escherichia coli O157:H7 str. EC4401 RefSeq   IS629 transposase orfA
ref|ZP_02783510.1 Escherichia coli O157:H7 str. EC4401 RefSeq   IS629 transposase orfA
ref|ZP_02785139.1 Escherichia coli O157:H7 str. EC4501 RefSeq   IS629 transposase orfA
ref|ZP_02785528.1 Escherichia coli O157:H7 str. EC4501 RefSeq   IS1203 transposase orfA
ref|ZP_02786324.1 Escherichia coli O157:H7 str. EC4501 RefSeq   IS629 transposase orfA
ref|ZP_02786909.1 Escherichia coli O157:H7 str. EC4501 RefSeq   IS629 transposase orfA
ref|ZP_02787114.1 Escherichia coli O157:H7 str. EC4501 RefSeq   IS629 transposase orfA
ref|ZP_02787426.1 Escherichia coli O157:H7 str. EC4501 RefSeq   IS629 transposase orfA
ref|ZP_02787653.1 Escherichia coli O157:H7 str. EC4501 RefSeq   IS629 transposase orfA
ref|ZP_02788170.1 Escherichia coli O157:H7 str. EC4501 RefSeq   IS1203 transposase orfA
ref|ZP_02788882.1 Escherichia coli O157:H7 str. EC4501 RefSeq   IS629 transposase orfA
ref|ZP_02789784.1 Escherichia coli O157:H7 str. EC4501 RefSeq   IS1203 transposase orfA
ref|ZP_02790072.1 Escherichia coli O157:H7 str. EC4501 RefSeq   IS629 transposase orfA
ref|ZP_02790124.1 Escherichia coli O157:H7 str. EC4501 RefSeq   IS629 transposase orfA
ref|ZP_02790483.1 Escherichia coli O157:H7 str. EC4501 RefSeq   IS629 transposase orfA
ref|ZP_02792002.1 Escherichia coli O157:H7 str. EC4486 RefSeq   IS629 transposase orfA
ref|ZP_02792435.1 Escherichia coli O157:H7 str. EC4486 RefSeq   IS1203 transposase orfA
ref|ZP_02792645.1 Escherichia coli O157:H7 str. EC4486 RefSeq   IS1203 transposase orfA
ref|ZP_02792878.1 Escherichia coli O157:H7 str. EC4486 RefSeq   IS629 transposase orfA
ref|ZP_02793013.1 Escherichia coli O157:H7 str. EC4486 RefSeq   IS629 transposase orfA
ref|ZP_02793721.1 Escherichia coli O157:H7 str. EC4486 RefSeq   IS629 transposase orfA
ref|ZP_02794144.1 Escherichia coli O157:H7 str. EC4486 RefSeq   IS629 transposase orfA
ref|ZP_02794247.1 Escherichia coli O157:H7 str. EC4486 RefSeq   IS629 transposase orfA
ref|ZP_02794615.1 Escherichia coli O157:H7 str. EC4486 RefSeq   IS1203 transposase orfA
ref|ZP_02794753.1 Escherichia coli O157:H7 str. EC4486 RefSeq   IS1203 transposase orfA
ref|ZP_02795316.1 Escherichia coli O157:H7 str. EC4486 RefSeq   IS629 transposase orfA
ref|ZP_02796018.1 Escherichia coli O157:H7 str. EC4486 RefSeq   IS629 transposase orfA
ref|ZP_02796570.1 Escherichia coli O157:H7 str. EC4486 RefSeq   IS1203 transposase orfA
ref|ZP_02797900.1 Escherichia coli O157:H7 str. EC4196 RefSeq   IS629 transposase orfA
ref|ZP_02798037.1 Escherichia coli O157:H7 str. EC4196 RefSeq   IS629 transposase orfA
ref|ZP_02798379.1 Escherichia coli O157:H7 str. EC4196 RefSeq   IS629 transposase orfA
ref|ZP_02799852.1 Escherichia coli O157:H7 str. EC4196 RefSeq   IS629 transposase orfA
ref|ZP_02800453.1 Escherichia coli O157:H7 str. EC4196 RefSeq   IS1203 transposase orfA
ref|ZP_02800564.1 Escherichia coli O157:H7 str. EC4196 RefSeq   IS1203 transposase orfA
ref|ZP_02800806.1 Escherichia coli O157:H7 str. EC4196 RefSeq   IS629 transposase orfA
ref|ZP_02800933.1 Escherichia coli O157:H7 str. EC4196 RefSeq   IS629 transposase orfA
ref|ZP_02801119.1 Escherichia coli O157:H7 str. EC4196 RefSeq   IS629 transposase orfA
ref|ZP_02801733.1 Escherichia coli O157:H7 str. EC4196 RefSeq   IS629 transposase orfA
ref|ZP_02802131.1 Escherichia coli O157:H7 str. EC4196 RefSeq   IS629 transposase orfA
ref|ZP_02802332.1 Escherichia coli O157:H7 str. EC4196 RefSeq   IS1203 transposase orfA
ref|ZP_02802487.1 Escherichia coli O157:H7 str. EC4196 RefSeq   IS629 transposase orfA
ref|ZP_02802696.1 Escherichia coli O157:H7 str. EC4196 RefSeq   IS629 transposase orfA
ref|ZP_02802837.1 Escherichia coli O157:H7 str. EC4196 RefSeq   IS1203 transposase orfA
ref|ZP_02803611.1 Escherichia coli O157:H7 str. EC4076 RefSeq   IS629 transposase orfA
ref|ZP_02805107.1 Escherichia coli O157:H7 str. EC4076 RefSeq   IS629 transposase orfA
ref|ZP_02805244.1 Escherichia coli O157:H7 str. EC4076 RefSeq   IS629 transposase orfA
ref|ZP_02805955.1 Escherichia coli O157:H7 str. EC4076 RefSeq   IS1203 transposase orfA
ref|ZP_02806855.1 Escherichia coli O157:H7 str. EC4076 RefSeq   IS629 transposase orfA
ref|ZP_02807285.1 Escherichia coli O157:H7 str. EC4076 RefSeq   IS1203 transposase orfA
ref|ZP_02807612.1 Escherichia coli O157:H7 str. EC4076 RefSeq   IS1203 transposase orfA
ref|ZP_02808016.1 Escherichia coli O157:H7 str. EC4076 RefSeq   IS629 transposase orfA
ref|ZP_02808675.1 Escherichia coli O157:H7 str. EC4076 RefSeq   IS1203 transposase orfA
ref|ZP_02808849.1 Escherichia coli O157:H7 str. EC4076 RefSeq   IS629 transposase orfA
ref|ZP_02808900.1 Escherichia coli O157:H7 str. EC4076 RefSeq   IS629 transposase orfA
ref|ZP_02808994.1 Escherichia coli O157:H7 str. EC4076 RefSeq   IS629 transposase orfA
ref|ZP_02809186.1 Escherichia coli O157:H7 str. EC4076 RefSeq   IS629 transposase orfA
ref|ZP_02810853.1 Escherichia coli O157:H7 str. EC869 RefSeq   IS629 transposase orfA
ref|ZP_02811033.1 Escherichia coli O157:H7 str. EC869 RefSeq   IS629 transposase orfA
ref|ZP_02812442.1 Escherichia coli O157:H7 str. EC869 RefSeq   IS1203 transposase orfA
ref|ZP_02812911.1 Escherichia coli O157:H7 str. EC869 RefSeq   IS629 transposase orfA
ref|ZP_02813826.1 Escherichia coli O157:H7 str. EC869 RefSeq   IS1203 transposase orfA
ref|ZP_02814376.1 Escherichia coli O157:H7 str. EC869 RefSeq   IS629 transposase orfA
ref|ZP_02814551.1 Escherichia coli O157:H7 str. EC869 RefSeq   IS629 transposase orfA
ref|ZP_02814945.1 Escherichia coli O157:H7 str. EC869 RefSeq   IS629 transposase orfA
ref|ZP_02815224.1 Escherichia coli O157:H7 str. EC869 RefSeq   IS629 transposase orfA
ref|ZP_02815411.1 Escherichia coli O157:H7 str. EC869 RefSeq   IS629 transposase orfA
ref|ZP_02822571.1 Escherichia coli O157:H7 str. EC508 RefSeq   IS629 transposase orfA
ref|ZP_02822853.1 Escherichia coli O157:H7 str. EC508 RefSeq   IS1203 transposase orfA
ref|ZP_02823422.1 Escherichia coli O157:H7 str. EC508 RefSeq   IS629 transposase orfA
ref|ZP_02823548.1 Escherichia coli O157:H7 str. EC508 RefSeq   IS1203 transposase orfA
ref|ZP_02825440.1 Escherichia coli O157:H7 str. EC508 RefSeq   IS629 transposase orfA
ref|ZP_02825513.1 Escherichia coli O157:H7 str. EC508 RefSeq   IS629 transposase orfA
ref|ZP_02825836.1 Escherichia coli O157:H7 str. EC508 RefSeq   IS629 transposase orfA
ref|ZP_02826304.1 Escherichia coli O157:H7 str. EC508 RefSeq   IS1203 transposase orfA
ref|ZP_02827148.1 Escherichia coli O157:H7 str. EC508 RefSeq   IS629 transposase orfA
ref|ZP_02827619.1 Escherichia coli O157:H7 str. EC508 RefSeq   IS1203 transposase orfA
ref|ZP_02827816.1 Escherichia coli O157:H7 str. EC508 RefSeq   IS1203 transposase orfA
ref|ZP_02827972.1 Escherichia coli O157:H7 str. EC508 RefSeq   IS629 transposase orfA
ref|ZP_03031454.1 Escherichia coli B7A RefSeq   IS629 transposase orfA
ref|ZP_03050243.1 Escherichia coli E110019 RefSeq   IS629 transposase orfA
ref|ZP_03051870.1 Escherichia coli E110019 RefSeq   IS629 transposase orfA
ref|ZP_03052490.1 Escherichia coli E110019 RefSeq   IS629 transposase orfA
ref|ZP_03080570.1 Escherichia coli O157:H7 str. EC4024 RefSeq   putative transposase
ref|ZP_03080714.1 Escherichia coli O157:H7 str. EC4024 RefSeq   putative transposase
ref|ZP_03081005.1 Escherichia coli O157:H7 str. EC4024 RefSeq   putative transposase
ref|ZP_03081134.1 Escherichia coli O157:H7 str. EC4024 RefSeq   putative transposase
ref|ZP_03082505.1 Escherichia coli O157:H7 str. EC4024 RefSeq   putative transposase
ref|ZP_03083339.1 Escherichia coli O157:H7 str. EC4024 RefSeq   putative transposase
ref|ZP_03084032.1 Escherichia coli O157:H7 str. EC4024 RefSeq   putative transposase
ref|ZP_03084206.1 Escherichia coli O157:H7 str. EC4024 RefSeq   putative transposase
ref|ZP_03084347.1 Escherichia coli O157:H7 str. EC4024 RefSeq   putative transposase
ref|ZP_03084720.1 Escherichia coli O157:H7 str. EC4024 RefSeq   putative transposase
ref|ZP_03084889.1 Escherichia coli O157:H7 str. EC4024 RefSeq   putative transposase
ref|ZP_03085060.1 Escherichia coli O157:H7 str. EC4024 RefSeq   putative transposase
ref|ZP_03085159.1 Escherichia coli O157:H7 str. EC4024 RefSeq   putative transposase
ref|ZP_03085397.1 Escherichia coli O157:H7 str. EC4024 RefSeq   putative transposase
ref|ZP_03085988.1 Escherichia coli O157:H7 str. EC4024 RefSeq   putative transposase
ref|ZP_03248077.1 Escherichia coli O157:H7 str. EC4206 RefSeq   IS629, transposase orfA
ref|ZP_03248381.1 Escherichia coli O157:H7 str. EC4206 RefSeq   IS629, transposase orfA
ref|ZP_03248420.1 Escherichia coli O157:H7 str. EC4206 RefSeq   IS629, transposase orfA
ref|ZP_03248968.1 Escherichia coli O157:H7 str. EC4206 RefSeq   IS629, transposase orfA
ref|ZP_03249152.1 Escherichia coli O157:H7 str. EC4206 RefSeq   IS629, transposase orfA
ref|ZP_03249232.1 Escherichia coli O157:H7 str. EC4206 RefSeq   IS629, transposase orfA
ref|ZP_03249395.1 Escherichia coli O157:H7 str. EC4206 RefSeq   IS629, transposase orfA
ref|ZP_03250029.1 Escherichia coli O157:H7 str. EC4206 RefSeq   IS629, transposase orfA
ref|ZP_03250128.1 Escherichia coli O157:H7 str. EC4206 RefSeq   IS629, transposase orfA
ref|ZP_03250658.1 Escherichia coli O157:H7 str. EC4206 RefSeq   IS629, transposase orfA
ref|ZP_03251292.1 Escherichia coli O157:H7 str. EC4206 RefSeq   IS629, transposase orfA
ref|ZP_03252114.1 Escherichia coli O157:H7 str. EC4206 RefSeq   IS629, transposase orfA
ref|ZP_03252305.1 Escherichia coli O157:H7 str. EC4206 RefSeq   IS629, transposase orfA
ref|ZP_03252543.1 Escherichia coli O157:H7 str. EC4206 RefSeq   IS629, transposase orfA
ref|ZP_03253077.1 Escherichia coli O157:H7 str. EC4206 RefSeq   IS629, transposase orfA
ref|ZP_03253789.1 Escherichia coli O157:H7 str. EC4045 RefSeq   IS629, transposase orfA
ref|ZP_03253845.1 Escherichia coli O157:H7 str. EC4045 RefSeq   IS629, transposase orfA
ref|ZP_03254354.1 Escherichia coli O157:H7 str. EC4045 RefSeq   IS629, transposase orfA
ref|ZP_03254407.1 Escherichia coli O157:H7 str. EC4045 RefSeq   IS629, transposase orfA
ref|ZP_03254532.1 Escherichia coli O157:H7 str. EC4045 RefSeq   IS629, transposase orfA
ref|ZP_03254771.1 Escherichia coli O157:H7 str. EC4045 RefSeq   IS629, transposase orfA
ref|ZP_03255824.1 Escherichia coli O157:H7 str. EC4045 RefSeq   IS629, transposase orfA
ref|ZP_03255851.1 Escherichia coli O157:H7 str. EC4045 RefSeq   IS629, transposase orfA
ref|ZP_03256020.1 Escherichia coli O157:H7 str. EC4045 RefSeq   IS629, transposase orfA
ref|ZP_03257297.1 Escherichia coli O157:H7 str. EC4045 RefSeq   IS629, transposase orfA
ref|ZP_03257892.1 Escherichia coli O157:H7 str. EC4045 RefSeq   IS629, transposase orfA
ref|ZP_03257941.1 Escherichia coli O157:H7 str. EC4045 RefSeq   IS629, transposase orfA
ref|ZP_03257955.1 Escherichia coli O157:H7 str. EC4045 RefSeq   IS629, transposase orfA
ref|ZP_03258263.1 Escherichia coli O157:H7 str. EC4045 RefSeq   IS629, transposase orfA
ref|ZP_03258479.1 Escherichia coli O157:H7 str. EC4045 RefSeq   IS629, transposase orfA
ref|ZP_03258876.1 Escherichia coli O157:H7 str. EC4042 RefSeq   IS629, transposase orfA
ref|ZP_03259038.1 Escherichia coli O157:H7 str. EC4042 RefSeq   IS629, transposase orfA
ref|ZP_03259138.1 Escherichia coli O157:H7 str. EC4042 RefSeq   IS629, transposase orfA
ref|ZP_03259403.1 Escherichia coli O157:H7 str. EC4042 RefSeq   IS629, transposase orfA
ref|ZP_03259642.1 Escherichia coli O157:H7 str. EC4042 RefSeq   IS629, transposase orfA
ref|ZP_03259816.1 Escherichia coli O157:H7 str. EC4042 RefSeq   IS629, transposase orfA
ref|ZP_03259903.1 Escherichia coli O157:H7 str. EC4042 RefSeq   IS629, transposase orfA
ref|ZP_03260488.1 Escherichia coli O157:H7 str. EC4042 RefSeq   IS629, transposase orfA
ref|ZP_03260662.1 Escherichia coli O157:H7 str. EC4042 RefSeq   IS629, transposase orfA
ref|ZP_03260736.1 Escherichia coli O157:H7 str. EC4042 RefSeq   IS629, transposase orfA
ref|ZP_03261882.1 Escherichia coli O157:H7 str. EC4042 RefSeq   IS629, transposase orfA
ref|ZP_03262094.1 Escherichia coli O157:H7 str. EC4042 RefSeq   IS629, transposase orfA
ref|ZP_03262539.1 Escherichia coli O157:H7 str. EC4042 RefSeq   IS629, transposase orfA
ref|ZP_03263348.1 Escherichia coli O157:H7 str. EC4042 RefSeq   IS629, transposase orfA
ref|ZP_03263658.1 Escherichia coli O157:H7 str. EC4042 RefSeq   IS629, transposase orfA
ref|ZP_03440917.1 Escherichia coli O157:H7 str. TW14588 RefSeq   IS629, transposase orfA
ref|ZP_03442305.1 Escherichia coli O157:H7 str. TW14588 RefSeq   IS629, transposase orfA
ref|ZP_03442448.1 Escherichia coli O157:H7 str. TW14588 RefSeq   IS629, transposase orfA
ref|ZP_03442752.1 Escherichia coli O157:H7 str. TW14588 RefSeq   IS629, transposase orfA
ref|ZP_03443274.1 Escherichia coli O157:H7 str. TW14588 RefSeq   IS629, transposase orfA
ref|ZP_03443680.1 Escherichia coli O157:H7 str. TW14588 RefSeq   IS629, transposase orfA
ref|ZP_03443702.1 Escherichia coli O157:H7 str. TW14588 RefSeq   IS629, transposase orfA
ref|ZP_03444476.1 Escherichia coli O157:H7 str. TW14588 RefSeq   IS629, transposase orfA
ref|ZP_03444514.1 Escherichia coli O157:H7 str. TW14588 RefSeq   IS629, transposase orfA
ref|ZP_03445399.1 Escherichia coli O157:H7 str. TW14588 RefSeq   IS629, transposase orfA
ref|ZP_03445668.1 Escherichia coli O157:H7 str. TW14588 RefSeq   IS629, transposase orfA
ref|ZP_03445809.1 Escherichia coli O157:H7 str. TW14588 RefSeq   IS629, transposase orfA
ref|ZP_03445918.1 Escherichia coli O157:H7 str. TW14588 RefSeq   IS629, transposase orfA
tr|B2NLP0 Escherichia coli O157:H7 str. EC4196 TrEMBL   IS1203 transposase orfA
tr|B2P1D2 Escherichia coli O157:H7 str. EC4113 TrEMBL   IS1203 transposase orfA
tr|B2PF12 Escherichia coli O157:H7 str. EC4076 TrEMBL   IS1203 transposase orfA
tr|B3A310 Escherichia coli O157:H7 str. EC4401 TrEMBL   IS1203 transposase orfA
tr|B3AIR5 Escherichia coli O157:H7 str. EC4486 TrEMBL   IS1203 transposase orfA
tr|B3AY26 Escherichia coli O157:H7 str. EC4501 TrEMBL   IS1203 transposase orfA
tr|B3BDW7 Escherichia coli O157:H7 str. EC869 TrEMBL   IS1203 transposase orfA
tr|B3BS61 Escherichia coli O157:H7 str. EC508 TrEMBL   IS1203 transposase orfA
tr|B3HKX3 Escherichia coli B7A TrEMBL   IS629 transposase orfA
tr|B3IKP4 Escherichia coli E110019 TrEMBL   IS629 transposase orfA
tr|B5YPD4 Escherichia coli O157:H7 (strain EC4115 / EHEC) TrEMBL   IS629, transposase orfA
tr|B6DZX4 Stx2-converting phage 1717 TrEMBL   Putative transposase
tr|B6ZR61 Escherichia coli O157:H7 str. TW14588 TrEMBL   IS629, transposase orfA
tr|Q6H9S7 Enterobacteria phage BP-4795 TrEMBL   Putative transposase OrfA protein of IS629
tr|Q7AK24 Enterobacteria phage VT2-Sa (Bacteriophage VT2-Sa) TrEMBL   Hypothetical 12kD protein
tr|Q7DBL5 Escherichia coli O157:H7 TrEMBL   Putative uncharacterized protein
tr|Q7DK18 Escherichia coli TrEMBL   Genes for Stx2 variant A and B subunit, ORFa and ORFb
tr|Q7Y2I4 Stx2 converting phage II TrEMBL   Putative uncharacterized protein
tr|Q9R3F7 Enterobacteria phage CP-1639 TrEMBL   And chromosomal integration site


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
8 fig|585396.4.peg.5907 Mobile element protein


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search