The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|585396.4.peg.5906: Escherichia coli O111:H- str. 11128

This feature in The SEED Viewer

NCBI Taxonomy Id: 585396

Current Assignment: Phage terminase, large subunit
Translate Function Assignments



Context on contig NC_013370 from base 86929 to 97179 (10251 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
5897 87144 86929 216 -           Lxr  
5898 87510 87175 336 - 30         hypothetical protein  
5899 87685 88074 390 + 174     1: 2   Error-prone repair protein UmuD locus|ECO111_p2-110, protein_id|YP_003238012.1, gi|260871232, geneID|8489925
5900 88147 88368 222 + 72     1: 1   Prevent host death protein, Phd antitoxin locus|ECO111_p2-111, protein_id|YP_003238013.1, gi|260871233, geneID|8489926
5901 88368 88748 381 + -1     1: 1   Death on curing protein, Doc toxin locus|ECO111_p2-112, protein_id|YP_003238014.1, gi|260871234, geneID|8489927
5902 88753 88932 180 + 4         PdcA locus|ECO111_p2-113, protein_id|YP_003238015.1, gi|260871235, geneID|8489928
5903 88960 90003 1044 + 27         Putative cytoplasmic protein locus|ECO111_p2-114, protein_id|YP_003238016.1, gi|260871236, geneID|8489929
5904 90170 90544 375 + 166         Late promoter-activating protein (Gp10) locus|ECO111_p2-115, protein_id|YP_003238017.1, gi|260871237, geneID|8489930
5905 90630 91823 1194 + 85         Terminase A protein (PACase A protein) (DNA packaging A protein) locus|ECO111_p2-116, protein_id|YP_003238018.1, gi|260871238, geneID|8489931
5906 91823 93307 1485 + -1         Phage terminase, large subunit locus|ECO111_p2-117, protein_id|YP_003238019.1, gi|260871239, geneID|8489932
5907 94800 93913 888 - 605         Mobile element protein locus|ECO111_p2-119, protein_id|YP_003238021.1, gi|260871241, geneID|8489934
5908 95126 94800 327 - -1         Insertion element IS401 (Burkholderia multivorans) transposase locus|ECO111_p2-120, protein_id|YP_003238022.1, gi|260871242, geneID|8489935
5909 95426 96295 870 + 299         putative antirepressor protein locus|ECO111_p2-121, protein_id|YP_003238023.1, gi|260871243, geneID|8489936
5910 97179 96328 852 - 32         C1.100 locus|ECO111_p2-122, protein_id|YP_003238024.1, gi|260871244, geneID|8489937

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|585396.4.peg.5906 Phage terminase, large subunit
MARSCVTDPRWRELVALYRYDWIAAADVLFGKTPTWQQDEIIESTQQDGSWTSVTSGHGT
GKSDMTSIIAILFIMFFPGARVILVANKRQQVLDGIFKYIKSNWATAVSRFPWLSKYFIL
TETSFFEVTGKGVWTILIKSCRSGNEEALAGEHADHLLYIIDEASGVSDKAFSVITGALT
GKDNRILLLSQPTRPSGYFYDSHHRLAIRPGNPDGLFTAIILNSEESPLVDAKFIRAKLA
EYGGRDNPMYMIKVRGEFPKSQDGFLLGRDEVERATRRKVKIAKGWGWVACVDVAGGTGR
DKSVINIMMVSGQRNKRRVINYRMLEYTDVTETQLAAKIFAECNPERFPNITIAIDGDGL
GKSTADLMYERYGITVQRIRWGKKMHSREDKSLYFDMRAFANIQAAEAVKSGRMRLDKGA
ATIEEASKIPVGINSAGQWKVMSKEDMKKKLNLHSPDHWDTYCFAMLANYVPQDEVLSVE
DEAQVDEALAWLNE

MD5 = 64d8af7c88fab5780845dbebfc7ff828


  DNA Sequence

>fig|585396.4.peg.5906 Phage terminase, large subunit
atggccagaagttgcgtaacggacccacgttggcgcgagctggtggcgctatatcgttat
gactggattgcggccgctgatgtgttgtttgggaagacaccaacctggcagcaggatgag
atcattgagtccacgcagcaggacggcagttggacaagtgtgacctccggccatggtact
ggtaagtcggatatgacgagtatcattgcaatactcttcatcatgtttttccccggcgct
cgcgttattctggtcgctaacaaaagacagcaagtccttgatggtattttcaaatacata
aagagcaattgggctactgctgttagcagattcccgtggttgtcgaagtatttcattctt
acagaaacgtctttttttgaggtgactggcaagggtgtttggacaatattgataaagtcc
tgtcgctccggaaatgaggaggcgttggctggtgaacacgccgatcatctcttgtatatc
atcgacgaagcgtcgggtgtgagtgataaagcattcagtgtgataacaggtgcgctgacc
ggtaaggataaccgtattctgcttctttcccagcctacgcgaccttcaggctatttctac
gattcacaccacagactagctattcgcccgggaaatcctgatggattgtttactgcgata
atactgaatagtgaagaatctccgcttgtagatgcaaaatttatacgagcaaaacttgcg
gagtatggcggtcgtgataaccccatgtacatgatcaaagtacgtggtgaatttcccaaa
tctcaagatggctttcttcttggtcgtgatgaggttgagcgggcgacgcggcgaaaggtc
aagattgccaaaggatggggctgggttgcatgtgttgacgttgctggtggcacaggacga
gataagtccgttattaatatcatgatggtgtccggccagcgaaataaacgccgtgtaatc
aactatcgtatgctggaatacacagacgttacagaaacgcagttagccgccaagattttc
gcagaatgtaacccagaacggttcccgaacataaccatagctattgatggcgatggcttg
gggaaatcgacggctgatctgatgtacgaacgctatggtattaccgtccagcgtatccgc
tggggtaaaaagatgcacagccgtgaagataaaagcctttatttcgatatgcgcgctttc
gcgaatattcaggcggcagaagctgtaaaatcagggcgtatgcggcttgataagggggct
gcgactatagaggaagcatcaaagataccggtagggataaattccgcaggtcaatggaag
gtgatgtcaaaggaagatatgaagaaaaaactcaacctgcactcaccggaccattgggat
acatattgtttcgctatgttggcgaactatgttccccaagatgaagtgcttagcgtcgaa
gacgaagcgcaggttgatgaagctctggcatggcttaatgaatga


  DNA with Flanking Sequence

>fig|585396.4.peg.5906 Phage terminase, large subunit
aacaccatttacagcatccggaataactatcgaaaagaaagccgggaggcggaaaagcac
gctttatctatggggcaagctggcattgttaagctggcatacgaacgaaagcgtgaaaat
aactggtcagtgctggaagcagctgaattcatcgaggcgcatggtgggaaagttccgccc
ctgatgctggagcaaatcaaagccgatctgcgtgctcctaagaccaataccgatgatgag
gaaaggcaaacagccgtcggtggcccttctcttgaagatctggacaaagttgcgcgagaa
cgggccgccagccgccgcgctgatgccgcattgtggattgagcatcgtagagaagaaatt
gccgatatcgtcgatacaggtggttatggtgatgtcgatgcggaaggcatatcaaacgaa
gcatggcttgaacaggatctggacgaaaacgaggaggaagacgaagaagttacccgcaaa
ctgtacggggatgatgattaatggccagaagttgcgtaacggacccacgttggcgcgagc
tggtggcgctatatcgttatgactggattgcggccgctgatgtgttgtttgggaagacac
caacctggcagcaggatgagatcattgagtccacgcagcaggacggcagttggacaagtg
tgacctccggccatggtactggtaagtcggatatgacgagtatcattgcaatactcttca
tcatgtttttccccggcgctcgcgttattctggtcgctaacaaaagacagcaagtccttg
atggtattttcaaatacataaagagcaattgggctactgctgttagcagattcccgtggt
tgtcgaagtatttcattcttacagaaacgtctttttttgaggtgactggcaagggtgttt
ggacaatattgataaagtcctgtcgctccggaaatgaggaggcgttggctggtgaacacg
ccgatcatctcttgtatatcatcgacgaagcgtcgggtgtgagtgataaagcattcagtg
tgataacaggtgcgctgaccggtaaggataaccgtattctgcttctttcccagcctacgc
gaccttcaggctatttctacgattcacaccacagactagctattcgcccgggaaatcctg
atggattgtttactgcgataatactgaatagtgaagaatctccgcttgtagatgcaaaat
ttatacgagcaaaacttgcggagtatggcggtcgtgataaccccatgtacatgatcaaag
tacgtggtgaatttcccaaatctcaagatggctttcttcttggtcgtgatgaggttgagc
gggcgacgcggcgaaaggtcaagattgccaaaggatggggctgggttgcatgtgttgacg
ttgctggtggcacaggacgagataagtccgttattaatatcatgatggtgtccggccagc
gaaataaacgccgtgtaatcaactatcgtatgctggaatacacagacgttacagaaacgc
agttagccgccaagattttcgcagaatgtaacccagaacggttcccgaacataaccatag
ctattgatggcgatggcttggggaaatcgacggctgatctgatgtacgaacgctatggta
ttaccgtccagcgtatccgctggggtaaaaagatgcacagccgtgaagataaaagccttt
atttcgatatgcgcgctttcgcgaatattcaggcggcagaagctgtaaaatcagggcgta
tgcggcttgataagggggctgcgactatagaggaagcatcaaagataccggtagggataa
attccgcaggtcaatggaaggtgatgtcaaaggaagatatgaagaaaaaactcaacctgc
actcaccggaccattgggatacatattgtttcgctatgttggcgaactatgttccccaag
atgaagtgcttagcgtcgaagacgaagcgcaggttgatgaagctctggcatggcttaatg
aatgaatatttgctctaataaattgtgttttttaactaccgatgttacattgagcctgac
ctcttgcgccttgaggcattttcggtttatgcttatcaggcacctcattaaaacgggtgc
cgggattggcctcccgcttaagtctaaggcgatacagacgccgctcgcgtctttttttgt
atcggcgtacacgcacacctctacaatggtgggctgtatggggctaccttcgggtaggct
ggttaccttggacgccagtaaggccaactccgtacagtccaccgccagcaagattggtct
cttctgcggtggttacataccaacgtctaaggaggctgccaatatggctactatccctac
cccaactcatcctgaatttatctggcgcttttactcctgccaaaaacgtcactatcactt
cgttattgcaccaacagaagatgaggctcgctctcagcttcctgacgccccatgtatttt
ctctgcccgtttttccactgattca


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
dbj|BAI39311.1 Escherichia coli O111:H- str. 11128     DNA packaging protein
gi|257767818 Escherichia coli O111:H- str. 11128 NCBI   DNA packaging protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search