The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|585152.3.peg.1832: Staphylococcus aureus subsp. aureus D139

This feature in The SEED Viewer

NCBI Taxonomy Id: 585152

Current Assignment: Phage phi 11 orf9 protein homolog
Translate Function Assignments



Context on contig NZ_GG730178 from base 49166 to 59558 (10393 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1821 50029 49166 864 -           FIG01108033: hypothetical protein  
1822 50095 50376 282 + 65         Phage protein  
1823 51186 50515 672 - 138         Hypothetical protein, PV83 orf19 homolog [SA bacteriophages 11, Mu50B]  
1824 51750 51199 552 - 12         Phage ssDNA binding protein  
1825 52567 51779 789 - 28         Phage phi 11 orf12 protein homolog  
1826 52781 52560 222 - -8         Phage phi-ETA orf16 protein homolog  
1827 53051 52791 261 - 9         Hypothetical protein, PVL orf39 homolog [SA bacteriophages 11, Mu50B]  
1828 53358 53056 303 - 4         Hypothetical protein, SAV0860 homolog [SA bacteriophages 11, Mu50B]  
1829 53771 53451 321 - 92         ORF048  
1830 53939 53772 168 - 0         ORF101  
1831 54153 53932 222 - -8         Hypothetical protein, PV83 orf12 homolog [SA bacteriophages 11, Mu50B]  
1832 54616 54167 450 - 13         Phage phi 11 orf9 protein homolog  
1833 55919 55560 360 - 943         Phage antirepressor protein  
1834 55976 56185 210 + 56         Phage protein  
1835 56318 56175 144 - -11         Phage protein  
1836 56543 56349 195 - 30         ORF077  
1837 57324 56560 765 - 16         Phage antirepressor protein  
1838 57518 57324 195 - -1         Phage repressor  
1839 57781 58113 333 + 262         Phage transcriptional regulator, Cro/CI family  
1840 58130 58804 675 + 16         Similarity  
1841 58833 59558 726 + 28         FIG01108866: hypothetical protein  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|585152.3.peg.1832 Phage phi 11 orf9 protein homolog
MNALYKTTLLTTMAVVTWKVWKIERNTRKPVINRNDFSKESTAETIERHSDPDSGIKLLK
AFSDFTKQAEKQKPTLGEVYRRNKPELPTVTLDENGLFINDFRVPYVLEEGVNVKKSMNN
LYKVSLDFFAKSIIADNYEADNPENQQLF

MD5 = ccb577a1991dd4ddde23981900daad2f


  DNA Sequence

>fig|585152.3.peg.1832 Phage phi 11 orf9 protein homolog
atgaacgcactatacaaaacaaccctcctcaccacaatggcagttgtgacgtggaaggtt
tggaagattgaacgaaatacgagaaagcctgtaatcaatcggaatgattttagtaaagag
tctacagcagaaacgattgagcgacacagtgatcctgattcaggaataaaactacttaag
gcattttccgacttcactaaacaagctgaaaagcaaaaacctacactaggagaagtttat
agacggaacaaacctgaattaccaaccgttactttagacgaaaacggactgtttataaat
gattttagggtgccttatgtacttgaggaaggggttaacgtaaagaaatctatgaacaac
ctatataaggtcagtttggactttttcgctaaaagtattattgcagataattacgaagca
gataacccagagaatcaacagttattttaa


  DNA with Flanking Sequence

>fig|585152.3.peg.1832 Phage phi 11 orf9 protein homolog
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnntaaaggacaacaatactttgttaacaagtttttaggagaaaaacaaacaa
cttaataggaggaattacaaatgaacgcactatacaaaacaaccctcctcaccacaatgg
cagttgtgacgtggaaggtttggaagattgaacgaaatacgagaaagcctgtaatcaatc
ggaatgattttagtaaagagtctacagcagaaacgattgagcgacacagtgatcctgatt
caggaataaaactacttaaggcattttccgacttcactaaacaagctgaaaagcaaaaac
ctacactaggagaagtttatagacggaacaaacctgaattaccaaccgttactttagacg
aaaacggactgtttataaatgattttagggtgccttatgtacttgaggaaggggttaacg
taaagaaatctatgaacaacctatataaggtcagtttggactttttcgctaaaagtatta
ttgcagataattacgaagcagataacccagagaatcaacagttattttaaaggaggaaaa
gatatgatgaaaaatagtttgcaagctaaagaacttgcagtaattttatctgtttctaaa
tccaaagcaggacaaataataagagaactgaataaagagcttgaagacgaaggttacatt
gcgatacgaggcaaaataccagtccaattagctaggaaaaaattcccttatcacgactta
tcagaccagagaataatggaggagttgaaaaaagaaaatgagtaaaacttataaaagcta
cctattagcagtattgtgcttcacagtcttagcgattgtactcatgccgtttctatactt
cactacagcatggtcaattgcgggattcgcaagtatcgcaactttcatattttataaaga
atacttttatgaggtggatgattaaatgacttggttcgaagaacacgttgaacctagtgt
ggaatgggaaagaaaagcagaacaagctgtgttaagcgatgatgaagttaagacgattac
tgaatacaga


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT05SA1881 Staphylococcus aureus NCTC 8325     conserved hypothetical protein
fig|12360.1.peg.9 Staphylococcus aureus phage phi 11 FIG   Phage phi 11 orf9 protein homolog
fig|320837.3.peg.47 Bacteriophage 42e FIG   Phage phi 11 orf9 protein homolog
fig|585151.3.peg.1555 Staphylococcus aureus subsp. aureus C427 FIG   Phage phi 11 orf9 protein homolog
fig|93061.3.peg.1963 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Phage phi 11 orf9 protein homolog
fig|93061.5.peg.1886 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Phage phi 11 orf9 protein homolog
gb|AAL82237.1 Staphylococcus aureus phage phi 11     phi PV83 orf 10-like protein
gb|AAX91141.1 Bacteriophage 42e     ORF029
gb|ABD31130.1 Staphylococcus aureus subsp. aureus NCTC 8325     phi PV83 orf 10-like protein
gi|18920496 Staphylococcus aureus phage phi 11 NCBI   phi PV83 orf 10-like protein
gi|29028572 Staphylococcus phage 11 NCBI   phi PV83 orf 10-like protein
gi|62636030 Bacteriophage 42e NCBI   ORF029
gi|66395537 Staphylococcus phage 42E NCBI   ORF029
gi|87203320 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   phi PV83 orf 10-like protein
gi|88195762 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   phi PV83 orf 10-like protein
img|637894705 Staphylococcus aureus aureus NCTC 8325 IMG   phi PV83 orf 10-like protein
img|638297004 Staphylococcus phage 11 IMG   phi PV83 orf 10-like protein
img|638314318 Bacteriophage 42e IMG   ORF029
kegg|sao:SAOUHSC_02078 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   phi PV83 orf 10-like protein
ref|NP_803262.1 Staphylococcus phage 11 RefSeq   phi PV83 orf 10-like protein
ref|YP_239899.1 Staphylococcus phage 42E RefSeq   ORF029
ref|YP_500571.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   phi PV83 orf 10-like protein
tr|Q2FX27 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Phi PV83 orf 10-like protein
tr|Q4ZCX7 Staphylococcus phage 42E TrEMBL   ORF029
tr|Q8SDW8 Staphylococcus phage phi11 (Bacteriophage phi-11) TrEMBL   Phi PV83 orf 10-like protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search