The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|585034.4.peg.2624: Escherichia coli IAI1

This feature in The SEED Viewer

NCBI Taxonomy Id: 585034

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NC_011741 from base 2749749 to 2762172 (12424 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2617 2751671 2749749 1923 -           DNA primase, phage associated locus|ECIAI1_2654, protein_id|YP_002388037.1, gi|218555124, geneID|7127759
2618 2751657 2752094 438 + -15         FIG00642878: hypothetical protein  
2619 2752806 2752955 150 + 711         hypothetical protein locus|ECIAI1_2656, protein_id|YP_002388039.1, gi|218555126, geneID|7127761
2620 2753835 2753374 462 - 418         FIG00640814: hypothetical protein locus|ECIAI1_2658, protein_id|YP_002388041.1, gi|218555128, geneID|7127763
2621 2754112 2754261 150 + 276         FIG00642688: hypothetical protein locus|ECIAI1_2659, protein_id|YP_002388042.1, gi|218555129, geneID|7125497
2622 2754258 2755160 903 + -4         FIG00639749: hypothetical protein locus|ECIAI1_2660, protein_id|YP_002388043.1, gi|218555130, geneID|7127765
2623 2755163 2756464 1302 + 2 9   cwn Phage protein locus|ECIAI1_2661, protein_id|YP_002388044.1, gi|218555131, geneID|7127766
2624 2756480 2757028 549 + 15     cwn hypothetical protein locus|ECIAI1_2662, protein_id|YP_002388045.1, gi|218555132, geneID|7127767
2625 2757757 2759820 2064 + 728 13   cwh DNA polymerase, phage-associated locus|ECIAI1_2664, protein_id|YP_002388047.1, gi|218555134, geneID|7127769
2626 2759885 2760646 762 + 64         FIG00639350: hypothetical protein locus|ECIAI1_2665, protein_id|YP_002388048.1, gi|218555135, geneID|7127770
2627 2760710 2760844 135 + 63         FIG00640685: hypothetical protein  
2628 2761075 2761362 288 + 230 5   cwn Phage protein locus|ECIAI1_2667, protein_id|YP_002388050.1, gi|218555137, geneID|7127772
2629 2762172 2761375 798 - 12         FIG00641157: hypothetical protein locus|ECIAI1_2668, protein_id|YP_002388051.1, gi|218555138, geneID|7127773

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|585034.4.peg.2624 hypothetical protein
MKLKLNNVRLAFPSLFEAKTVNGEGDPRFSAVFLMSPKHPQLEEIRKAMKQVAKEKWGEK
WEPIYNQLEKKLNLCLHDGDEKAEYEGFPGNFFLNAANKARPAVLDRDRSPLIQADGRPY
AGCYVNAVIDIWAQDNNFGKRINASLSGVQFLRDGDAFAGGGVASADDFDDISEGADAEA
LI

MD5 = 07a8d021e0c66727e056bfb59722739f


  DNA Sequence

>fig|585034.4.peg.2624 hypothetical protein
atgaaactgaagctgaacaatgttcgtctggccttcccgtctctgtttgaagctaaaact
gtaaacggcgaaggcgatccacgtttctccgcagtatttttaatgtcacccaaacaccca
caactggaagaaatccgtaaagctatgaagcaggtagcgaaggaaaaatggggagagaag
tgggagcccatttataaccagctggagaaaaaactcaatctgtgcctgcatgatggtgat
gaaaaagcagagtatgaaggcttccccggtaatttcttcctgaatgctgctaacaaagcg
cgcccagctgttcttgatcgcgatcgttcgccacttattcaggctgacggacgtccctat
gcagggtgctatgtaaacgccgttatcgatatctgggcacaggacaataatttcggtaaa
cgcattaatgcctcactcagcggagtccagttcctgcgagacggcgatgcattcgctggc
ggcggagtggcaagcgctgacgatttcgacgatatcagcgaaggtgctgatgctgaagca
ctaatttaa


  DNA with Flanking Sequence

>fig|585034.4.peg.2624 hypothetical protein
tgacaaagcctgtcagcgaaataatcaccaatgccagcgcacgtgtacctctgttaacca
ttgagcagcttgcggagatctatagccaggccgactttattgaatcctggctaaaggcag
tacgagaccgggttcacaatgaactcaatgccggacatccggtaccggggtttaaactgg
taacaggaaaacaaggtaaccgggcctggagtgatgaagaggcagctcgcgcacttctga
aggaccagttcaggtacaaaactgaagaagtattcgactttaaacttattagccccacaa
aagccgaaaaacttatcaaaaaggccagtccgcgccgttggtcaaaagtcgaggcactga
taacacgagctgatggtaaacccaccatcgttcccgagtcagacccacgccccgcactca
atatcaaccctgtaaatgatttcgacgacgtatccgacgatacgctaaccgcagacctca
tctgatttaaggaaatacccatgaaactgaagctgaacaatgttcgtctggccttcccgt
ctctgtttgaagctaaaactgtaaacggcgaaggcgatccacgtttctccgcagtatttt
taatgtcacccaaacacccacaactggaagaaatccgtaaagctatgaagcaggtagcga
aggaaaaatggggagagaagtgggagcccatttataaccagctggagaaaaaactcaatc
tgtgcctgcatgatggtgatgaaaaagcagagtatgaaggcttccccggtaatttcttcc
tgaatgctgctaacaaagcgcgcccagctgttcttgatcgcgatcgttcgccacttattc
aggctgacggacgtccctatgcagggtgctatgtaaacgccgttatcgatatctgggcac
aggacaataatttcggtaaacgcattaatgcctcactcagcggagtccagttcctgcgag
acggcgatgcattcgctggcggcggagtggcaagcgctgacgatttcgacgatatcagcg
aaggtgctgatgctgaagcactaatttaaccctacttcatagacgcccggttaaacaccg
ggctactgattaggcgtataatcactcaggaatcttaatctttctcaattctttatttag
ttcacagatctttttcttagacgggaaagtatcatacatccaaaaaccaacagtctctaa
aactattatcataaccatatacacaagataatttaaaaggccttcattttgccctatgga
aataatgcagataatagaaaaaagggtaaacagcacaaaacacagaaaggaaaacagacg
actaataataaataaaaaacctgaaaaatcaacattaataaaaaacactccgttatcttt
ctctatataattctgaagcttaaccaactgatttatatactgtcttttttctaatctatt
gcaaatgtaaataacatctcttcggttataagaggattgcaatttcagcgcatcacgaat
aattttatcatttattcttttttctatggcactcttatcctcctcatcc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
emb|CAQ99500.1 Escherichia coli IAI1 EMBL   conserved hypothetical protein from bacteriophage origin
fig|585034.5.peg.2623 Escherichia coli IAI1 FIG   hypothetical protein
gi|218361900 Escherichia coli IAI1 NCBI   conserved hypothetical protein from bacteriophage origin
gi|218555132 Escherichia coli IAI1 NCBI   conserved hypothetical protein from bacteriophage origin
kegg|ecr:ECIAI1_2662 Escherichia coli IAI1 KEGG   conserved hypothetical protein from bacteriophage origin
ref|YP_002388045.1 Escherichia coli IAI1 RefSeq   conserved hypothetical protein from bacteriophage origin
tr|B7M8G4 Escherichia coli O8 (strain IAI1) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
9 fig|585034.4.peg.2623 Phage protein
13 fig|585034.4.peg.2625 DNA polymerase, phage-associated
5 fig|585034.4.peg.2628 Phage protein


  Attributes

Help on Attributes

Key
Link Explains Key
Value
evidence_code cwn


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search