The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|575607.3.peg.714: Lactobacillus jensenii SJ-7A-US

This feature in The SEED Viewer

NCBI Taxonomy Id: 575607

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig NZ_GG704683 from base 358452 to 369846 (11395 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
704 359060 358452 609 -           hypothetical protein  
705 359296 359063 234 - 2         hypothetical protein  
706 359706 359299 408 - 2         hypothetical protein  
707 360571 359906 666 - 199         hypothetical protein  
708 361033 360581 453 - 9     3: 2 4 3   Single-stranded DNA-binding protein  
709 361668 361030 639 - -4         hypothetical protein  
710 362382 361684 699 - 15 5     Lj965 prophage replication protein  
711 362868 362392 477 - 9         Phage protein  
712 363323 363045 279 - 176         Phage related protein  
713 363598 363377 222 - 53         hypothetical protein  
714 364551 363781 771 - 182       Phage antirepressor protein  
715 364773 364582 192 - 30         hypothetical protein  
716 364925 365236 312 + 151         transcriptional regulator  
717 365269 365688 420 + 32         hypothetical protein  
718 366350 366523 174 + 661         hypothetical protein  
719 366684 366541 144 - 17         hypothetical protein  
720 366746 367897 1152 + 61         integrase  
721 368407 368168 240 - 270         FIG00751429: hypothetical protein  
722 369846 368491 1356 - 83     1: 1   Uncharacterized MFS-type transporter  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|575607.3.peg.714 Phage antirepressor protein
MNNLQVFNFEDARVRTVSIDGKPYFVGKDVAEILGYSNGSRDINRHVDSEDRQNYQNGTF
ESPRGLTVINESGLYSLILSSKLPTAKKFKRWVTSEVLPTIRKHGAYMTEQKIEEALLNP
DTLITLAKQLKAEKEQRLLAQKQVEEMTPKAIFHDAVASAENTMLVRDVAHFLRQNGVDI
GGTRFFVWLRLNGFLTKNNQPTQLSLERGYFRVKETVVHTNHGFKTKTTPKITGRGQTFF
LKKMLKEQEEKRAMGL

MD5 = 648e7ec432a9a6278fc897c2345f0699


  DNA Sequence

>fig|575607.3.peg.714 Phage antirepressor protein
atgaataacttacaagttttcaattttgaagatgcgagagtaaggacagtatcaattgat
ggtaagccttatttcgtaggcaaggatgttgccgaaattttaggatactcaaacggcagt
cgagatattaatcgacatgttgattcagaagaccggcaaaactaccaaaacggtactttt
gaatctccacgaggattgacggtaatcaacgaatcaggactatatagtttgattctcagt
agcaagttaccaacggccaagaaattcaagcgctgggtaacttccgaagtcctaccgaca
atcagaaagcacggcgcatacatgaccgagcaaaaaatcgaggaagcactgcttaaccca
gatacgctgattacacttgctaagcaactcaaagcagaaaaggaacaacgcttgctagca
cagaagcaagtcgaggaaatgacgcctaaggcaatattccatgatgcagtagccagtgca
gaaaacacaatgttggttagggatgtagctcacttcttaagacagaacggtgtagatatt
ggcggtactcgattctttgtctggctaagactaaacggcttcttgactaagaacaaccag
ccaacgcaattatcactggagcgtggatatttcagagttaaggaaaccgtggtacacaca
aaccacgggttcaaaacaaaaaccacgccaaagataaccggacgtggtcaaacattcttt
ttgaagaagatgcttaaggaacaagaagaaaagagagcgatgggactatga


  DNA with Flanking Sequence

>fig|575607.3.peg.714 Phage antirepressor protein
atggctcatttctacctaattcccaaccagagatagttgttggtttaacatttagcattt
ttgctaattctttttgagttagatgatgttcattacgtaagtatttgattcttgatgaga
tattcataaactacacctctcaatcgttaaaaatgatttaatacacttaaagtatatcaa
ctttatacaaaataactagaaaaatcgataaaatgtgttgcaaatatattaatcgtgtac
tatactaaacgtgtactttgatgaaaggagcaataaaaatggaatttacaattaaacaag
ctcgaaactattccagccggacacaagctgaaatggccaaagaactaggagtatcattac
caacctatcgagaatatgaacatggcaatatacagatgaaagttgaaacagctaagctct
tcgctaaagttgttaatgttccatttgaaaatattattttttgcaattaaactacacgat
acgtatattagaggtgcgatatgaataacttacaagttttcaattttgaagatgcgagag
taaggacagtatcaattgatggtaagccttatttcgtaggcaaggatgttgccgaaattt
taggatactcaaacggcagtcgagatattaatcgacatgttgattcagaagaccggcaaa
actaccaaaacggtacttttgaatctccacgaggattgacggtaatcaacgaatcaggac
tatatagtttgattctcagtagcaagttaccaacggccaagaaattcaagcgctgggtaa
cttccgaagtcctaccgacaatcagaaagcacggcgcatacatgaccgagcaaaaaatcg
aggaagcactgcttaacccagatacgctgattacacttgctaagcaactcaaagcagaaa
aggaacaacgcttgctagcacagaagcaagtcgaggaaatgacgcctaaggcaatattcc
atgatgcagtagccagtgcagaaaacacaatgttggttagggatgtagctcacttcttaa
gacagaacggtgtagatattggcggtactcgattctttgtctggctaagactaaacggct
tcttgactaagaacaaccagccaacgcaattatcactggagcgtggatatttcagagtta
aggaaaccgtggtacacacaaaccacgggttcaaaacaaaaaccacgccaaagataaccg
gacgtggtcaaacattctttttgaagaagatgcttaaggaacaagaagaaaagagagcga
tgggactatgaacaacgtaccagaaaagaaatgcatgatgtgcgataaggacttaactaa
gtcagattgcatttatacagatatcgaccaccacattttctgcagtatcgaatgcatagg
aaattggagcgtttcagacagattcgaaagctggaacgaatacaaaggatattactttta
ttaggagaacaaaatgaacgaattggaaagaaaaattaaagcacttggtcaaatctataa
tttaaaccaattatccaaagaggattttatcagcgtgatgtgtacttacattcaggctta
tgccgattataacgatatcgataaagaaataattacaacttatattttttcaattatgca
attatctcaatcagaaattagaagaatggttgaagaaattgaagaagaggactagctatg
gatctaatcaataaaaaaagcctgcaagaactcatcagggcgactttcatggaaatgaag
ccacgccttgaagaggaacttacaggaagaa


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
5 fig|575607.3.peg.710 Lj965 prophage replication protein


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search