The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|575604.3.peg.977: Lactobacillus gasseri SV-16A-US

This feature in The SEED Viewer

NCBI Taxonomy Id: 575604

Current Assignment: Dephospho-CoA kinase (EC 2.7.1.24)
Translate Function Assignments



Context on contig ADDY01000015 from base 124213 to 136144 (11932 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
969 124365 124213 153 -           Lj928 prophage recombination protein  
970 124797 124513 285 - 147         hypothetical protein  
971 125599 124811 789 - 13         Phage antirepressor protein  
972 125839 125612 228 - 12         hypothetical protein  
973 125989 126597 609 + 149         SOS-response repressor and protease LexA (EC 3.4.21.88)  
974 126608 127201 594 + 10         hypothetical protein  
975 127226 127879 654 + 24         Phage protein  
976 128066 129190 1125 + 186         putative integrase  
977 129900 129304 597 - 113   9: 1 4 9 5 7 10 2 8 6   Dephospho-CoA kinase (EC 2.7.1.24)  
978 130727 129897 831 - -4 9 1: 3   Formamidopyrimidine-DNA glycosylase (EC 3.2.2.23)  
979 133403 130743 2661 - 15 13     DNA polymerase I (EC 2.7.7.7)  
980 134687 133506 1182 - 102         Diaminopropionate ammonia-lyase (EC 4.3.1.15)  
981 136144 134750 1395 - 62         FIG00745206: hypothetical protein  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
rlmN El_Yacoubi_Basma_user Dephospho-CoA kinase (EC 2.7.1.24)
coA-FolK vcrecy Dephospho-CoA kinase (EC 2.7.1.24)
CoA_Test Dephospho-CoA kinase (EC 2.7.1.24)
COG2320_family SvetaG Dephospho-CoA kinase (EC 2.7.1.24)
Coenzyme_A_Biosynthesis AndreiO Dephospho-CoA kinase (EC 2.7.1.24)
dcernst_CoA_Salvage2 Ernst_Dustin_user Dephospho-CoA kinase (EC 2.7.1.24)
CoA_#2 ZALLOT_Remi_user Dephospho-CoA kinase (EC 2.7.1.24)
Coenzyme_A_Biosynthesis_tests ZALLOT_Remi_user Dephospho-CoA kinase (EC 2.7.1.24)
Pantothenate_biosynthesis_PanGenomes Smajic_Semra_user Dephospho-CoA kinase (EC 2.7.1.24)


  Protein Sequence

>fig|575604.3.peg.977 Dephospho-CoA kinase (EC 2.7.1.24)
MTYFLGLTGGIASGKSTADEFFEKQNIPIIDSDLIAHQIMEVGQKGYQAIVNYFGSNILN
DDQTINRHKLGGIVFNDKTKLKKLNEITHPLVHQKIKQQMERYRLNQEKLVVVDVPLLFE
SGFESLCDGVLVISISPKLQVKRLMKRNNFTKEEALVRINNQMPLSEKEKRATYVVANTG
TIDDLEKRLSDLLQKIGR

MD5 = 30150d6e90e149fd2029f3d904098e1b


  DNA Sequence

>fig|575604.3.peg.977 Dephospho-CoA kinase (EC 2.7.1.24)
atgacatattttttaggattaactggcggaatagccagtggcaaaagtacagctgatgaa
ttttttgaaaagcaaaatattccgattatcgactccgatttgattgctcatcagataatg
gaagtaggccaaaagggttatcaggcaatagttaattattttggcagcaatattcttaat
gatgatcaaacaattaatcgtcataaattaggtggaatagtttttaatgataaaactaag
ctgaaaaaattaaatgagataactcatccacttgttcatcagaaaattaaacaacaaatg
gagcgataccgtttaaatcaagaaaaattagttgtagttgatgtgcctttactatttgaa
tctggttttgaaagcttatgcgatggcgttttggttatttctatttcaccaaaactgcag
gttaaacgtctgatgaaacgaaataatttcactaaagaagaagctttggttagaataaat
aatcaaatgccactaagcgaaaaagaaaaaagagctacctatgtagtagctaatactggt
acaatagatgacttagagaaaagattatctgatttattacaaaagataggcaggtag


  DNA with Flanking Sequence

>fig|575604.3.peg.977 Dephospho-CoA kinase (EC 2.7.1.24)
gtgcgaaaattcggtaggatgcatttagttgaaacggggactgaaagaaaaacgactgga
attcgccatcttggacctgaacctaatactgctgaatttaacttaaagtattttgttgat
gccttgagccagaagaaaaagaatatcaagaacactttattagatcagacaattgtgtgt
ggtttaggaaatatttatgtagatgaagtgctctggaagagtaaaattcatcccctaagt
agtgctaaagctattcctgctgataaggtgaagaatttatatcaaaatattaaccatact
atcgctatagcaactaaggaacgtggaactactgttcatacttatttagatgctaatggt
gagattggtggctatcaaaaaatgctgcaagtttatggacatgctggtgaagagtgcagt
agttgcggcactattttagagaagatcaaagtaaatggacgcggaactactttctgtccg
cattgtcaggtactatataaatgacatattttttaggattaactggcggaatagccagtg
gcaaaagtacagctgatgaattttttgaaaagcaaaatattccgattatcgactccgatt
tgattgctcatcagataatggaagtaggccaaaagggttatcaggcaatagttaattatt
ttggcagcaatattcttaatgatgatcaaacaattaatcgtcataaattaggtggaatag
tttttaatgataaaactaagctgaaaaaattaaatgagataactcatccacttgttcatc
agaaaattaaacaacaaatggagcgataccgtttaaatcaagaaaaattagttgtagttg
atgtgcctttactatttgaatctggttttgaaagcttatgcgatggcgttttggttattt
ctatttcaccaaaactgcaggttaaacgtctgatgaaacgaaataatttcactaaagaag
aagctttggttagaataaataatcaaatgccactaagcgaaaaagaaaaaagagctacct
atgtagtagctaatactggtacaatagatgacttagagaaaagattatctgatttattac
aaaagataggcaggtagagaaaattggaatgtccaaaactccattaaaaaagcaatttac
cttatgtaaaccgctatatatcaagcattcttaactttatttgattaccttccacagaaa
aagcacagaattaaatgtttaaagcgtcaatggaacgaattatgttctgttggccttttt
tactttcatgagtataaatatttaaagtcatatctatggttgagtgtcctagaatttttt
gaacatctttgggagtgtttcctgttcctggctgtagcataagagtagcaaatgtatgtc
taaagccgtgaatggttatctgctttaaattggaattgtttttataaatcctttgtaacc
aatgtgccggtgtagctaagttaaggtggtctccatttgctttacagaagacaaagtcat
aaatattactgcgatacttcatcaagtctgctttcagactttttgacaatggtacatctc
tatatgattcttttgtttttggtggagcaataagttc


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
9 fig|575604.3.peg.978 Formamidopyrimidine-DNA glycosylase (EC 3.2.2.23)
13 fig|575604.3.peg.979 DNA polymerase I (EC 2.7.7.7)


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search