The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|575604.3.peg.972: Lactobacillus gasseri SV-16A-US

This feature in The SEED Viewer

NCBI Taxonomy Id: 575604

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig ADDY01000015 from base 120324 to 133403 (13080 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
963 120710 120324 387 -           Lj928 prophage protein  
964 121510 121208 303 - 497         hypothetical protein  
965 122364 121774 591 - 263         Lj965 prophage replication protein  
966 122336 122494 159 + -29         hypothetical protein  
967 123289 122486 804 - -9         Lj928 prophage protein  
968 124182 123292 891 - 2         Lj928 prophage replication protein  
969 124365 124213 153 - 30         Lj928 prophage recombination protein  
970 124797 124513 285 - 147         hypothetical protein  
971 125599 124811 789 - 13         Phage antirepressor protein  
972 125839 125612 228 - 12         hypothetical protein  
973 125989 126597 609 + 149         SOS-response repressor and protease LexA (EC 3.4.21.88)  
974 126608 127201 594 + 10         hypothetical protein  
975 127226 127879 654 + 24         Phage protein  
976 128066 129190 1125 + 186         putative integrase  
977 129900 129304 597 - 113     9: 1 4 9 5 7 10 2 8 6   Dephospho-CoA kinase (EC 2.7.1.24)  
978 130727 129897 831 - -4     1: 3   Formamidopyrimidine-DNA glycosylase (EC 3.2.2.23)  
979 133403 130743 2661 - 15         DNA polymerase I (EC 2.7.7.7)  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|575604.3.peg.972 hypothetical protein
MKFDLQRLKGERVARGITQAQMARKIGISTNAYWRKENGERDIGMEEFVKILSVLGFEKK
QISLFFAKDVHNSEH

MD5 = 86b7b6ed45ce3acb330e977268d0b368


  DNA Sequence

>fig|575604.3.peg.972 hypothetical protein
atgaagtttgatttgcaacgtttaaaaggtgagcgtgtagcacgaggaattacacaagct
caaatggcacgtaaaataggcattagtacgaatgcctattggagaaaggagaatggagaa
cgtgacattggtatggaagaatttgtcaagatcttaagtgtactaggtttcgaaaagaaa
caaatttcgcttttttttgcaaaagacgttcacaatagtgaacattaa


  DNA with Flanking Sequence

>fig|575604.3.peg.972 hypothetical protein
aagagcaaaaagagtgtcatctgcatatctatccatcatatattctggtatatatttttc
tatattttgttctgcagtaattggcgctcccatcgctatagttcctaataaaggaaccat
tcttggcttattttgattaataggttcaagccctaataaatcttcggttttaatatgtag
tgcttttgcaaaagctggtgctctatttataggaaattctcttgtgtggttgaagtatct
ggacacacctgatttggccattccaacgcgtctagctaattcactaattgatacgtcttg
ctcttctcttagttgatttaaataatcaattatttcttcactactgcgcattatttcacc
tcatctcttaatactaataatactccacttgttgacaaaaaaatacattttttatctttt
tttatgttttttgttgacaaaagaatacgataagaatattatatagttgttcttcaaagt
gaacgaattgaggtggaataatgaagtttgatttgcaacgtttaaaaggtgagcgtgtag
cacgaggaattacacaagctcaaatggcacgtaaaataggcattagtacgaatgcctatt
ggagaaaggagaatggagaacgtgacattggtatggaagaatttgtcaagatcttaagtg
tactaggtttcgaaaagaaacaaatttcgcttttttttgcaaaagacgttcacaatagtg
aacattaaggagatgaacaaatgaacgaaataattaatataaaagtccaaaacgatcagc
aacttgtttcagctagagatttgcataaaactttaggagctaaaaagaagtattctgaat
ggatttctcaaaatgtagcaggttttatagtgggtgtagattttacgaggtcacctgaaa
gttacctcgttaaaagtggcaatggaacagtacgaaaatacgatgatgttcttttaacaa
ttgaaacagcgaaacaaatttgcatgatgtcaaaaacatcaagaggtaaagaagttcgca
agtactttattcaagttgaaaagaactggaacaatccagatatgattatgcagcgtgcat
taaacatcgcaagcagtcgtgtaaagctacttgaaaataagaataaggaacttgaagacg
tcaatgcaaagcaggcagaaaaaattgccaaagatgctgacgatgtagtttttgcaaaag
ctattagatacagccaccatgcaattac


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search