The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|575604.3.peg.958: Lactobacillus gasseri SV-16A-US

This feature in The SEED Viewer

NCBI Taxonomy Id: 575604

Current Assignment: FIG00754532: hypothetical protein
Translate Function Assignments



Context on contig ADDY01000015 from base 112592 to 124182 (11591 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
949 113899 112592 1308 -           Terminase large subunit [Bacteriophage A118]  
950 114542 113865 678 - -35         FIG00746678: hypothetical protein  
951 114695 114558 138 - 15         hypothetical protein  
952 115409 114696 714 - 0         ParB domain protein nuclease  
953 115909 115412 498 - 2         hypothetical protein  
954 116574 115921 654 - 11         FIG00742244: hypothetical protein  
955 116982 116614 369 - 39         hypothetical protein  
rna.14 117186 117112 75 - 129         tRNA-Phe-GAA  
956 118460 117963 498 - 776         hypothetical protein  
957 118667 118476 192 - 15         hypothetical protein  
958 118824 118690 135 - 22         FIG00754532: hypothetical protein  
959 119020 118883 138 - 58         hypothetical protein  
960 119562 119101 462 - 80         Holliday junction resolvase  
961 119720 119559 162 - -4         hypothetical protein  
962 120306 120037 270 - 316         hypothetical protein  
963 120710 120324 387 - 17         Lj928 prophage protein  
964 121510 121208 303 - 497         hypothetical protein  
965 122364 121774 591 - 263         Lj965 prophage replication protein  
966 122336 122494 159 + -29         hypothetical protein  
967 123289 122486 804 - -9         Lj928 prophage protein  
968 124182 123292 891 - 2         Lj928 prophage replication protein  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|575604.3.peg.958 FIG00754532: hypothetical protein
MLKSNIRNFNELVEPTIEAMIDEDKAEELLAYIESEIKVRDRNN

MD5 = bbcacde21ad6e9a3e6abe9c7adfb887d


  DNA Sequence

>fig|575604.3.peg.958 FIG00754532: hypothetical protein
atgttgaaatcgaatattagaaattttaatgaacttgttgaaccaacaattgaagcaatg
attgatgaagacaaggcagaagagttactagcttatatagaaagtgaaatcaaagtaaga
gacagaaataattga


  DNA with Flanking Sequence

>fig|575604.3.peg.958 FIG00754532: hypothetical protein
accaagaattgcctactaagaagcctgatgctgataacgtgggcaagatcatcatggacg
gcatgaacccaaagatgaaacgtgataaacgacttcacaaaatgattgaggttatgagag
gtgtttaccacgatgacaagcaggtaacaactttgctagttaaaaagaggtatgccgaac
gtcctagggttgaagtgagaattaagagagatatgggtgattagatgaagcatagcgcag
aagtaatcgctgcagcagtaatgctaatttgcctaggagcagttggatttgtggtgtttg
tactatgagtgatcttaagtatcaaaaaggcgaatggtatcacgtacaggaagacggaac
acttaagcctgtagactatgacaaagaagtaaaagaatattacaagaagtggattgataa
ctatgaaattgtacggatatgaagtcaacacttgcaattataagaagttttcaacaggac
aacttgatgagtttagatcaatgttgaaatcgaatattagaaattttaatgaacttgttg
aaccaacaattgaagcaatgattgatgaagacaaggcagaagagttactagcttatatag
aaagtgaaatcaaagtaagagacagaaataattgataagtgagaggaaggatcagtaatg
aataatgattataggcgctatcacttagcgcatgatgaagcgtataagagcttaaatttg
atccataagtatgatactgcatcccttacggttaaagacttatgggagctaaaacaaata
gcatatcgtgaaggatatctgcgtgcaatggaagtaagacaatatagagattatggctta
gagggctagtttaggagtaggaatgtggaacatcaaaatacagacttaggacttgatatt
gatatggatatgacttccagcagagttatagaatttttaaaaaacacgttcccagaatat
gtgaggggcgctgcacttagtttagatgatttatctagccaaccctttaccggaatgcca
gcatctcatagtgcaattaactcacaagagcgtaagctagaaaaagcatgggagaaagta
gaacataacgaattacgagcagcaactgtttaccagaccattcttttatgccaga


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search