The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|572547.3.peg.1174: Aminobacterium colombiense DSM 12261

This feature in The SEED Viewer

NCBI Taxonomy Id: 572547

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NC_014011 from base 1155034 to 1166684 (11651 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1163 1155252 1155034 219 -           Two-component transcriptional response regulator, LuxR family  
1164 1156177 1155245 933 - -8         Phage DNA helicase loader locus|Amico_1131, protein_id|YP_003553978.1, gi|294102120, InterPro:IPR002611, InterPro:IPR003593, geneID|8964075
1165 1157043 1156174 870 - -4     1: 1   hypothetical protein locus|Amico_1132, protein_id|YP_003553979.1, gi|294102121, geneID|8964076
1166 1157510 1157073 438 - 29     4: 4 2 5 3   Deoxyuridine 5'-triphosphate nucleotidohydrolase (EC 3.6.1.23) locus|Amico_1133, protein_id|YP_003553980.1, gi|294102122, InterPro:IPR008180, InterPro:IPR008181, geneID|8964077
1167 1157959 1157600 360 - 89     1: 1   hypothetical protein locus|Amico_1134, protein_id|YP_003553981.1, gi|294102123, InterPro:IPR001589, geneID|8964078
1168 1158113 1157970 144 - 10     1: 1   hypothetical protein locus|Amico_1135, protein_id|YP_003553982.1, gi|294102124, geneID|8964079
1169 1158990 1158217 774 - 103         Phage antirepressor protein locus|Amico_1136, protein_id|YP_003553983.1, gi|294102125, InterPro:IPR003497, InterPro:IPR005039, geneID|8964080
1170 1159142 1158987 156 - -4     1: 1   hypothetical protein locus|Amico_1137, protein_id|YP_003553984.1, gi|294102126, geneID|8964081
1171 1159339 1159139 201 - -4     1: 1   hypothetical protein locus|Amico_1138, protein_id|YP_003553985.1, gi|294102127, geneID|8964082
1172 1159566 1159342 225 - 2     1: 1   hypothetical protein locus|Amico_1139, protein_id|YP_003553986.1, gi|294102128, geneID|8964083
1173 1159831 1159556 276 - -11     1: 1   hypothetical protein locus|Amico_1140, protein_id|YP_003553987.1, gi|294102129, geneID|8964084
1174 1160398 1160231 168 - 399     1: 1   hypothetical protein locus|Amico_1141, protein_id|YP_003553988.1, gi|294102130, InterPro:IPR001387, geneID|8964085
1175 1160642 1161322 681 + 243         Phage repressor protein cI locus|Amico_1142, protein_id|YP_003553989.1, gi|294102131, InterPro:IPR001387, InterPro:IPR019759, geneID|8964086
1176 1161394 1162812 1419 + 71     1: 1   hypothetical protein locus|Amico_1143, protein_id|YP_003553990.1, gi|294102132, geneID|8964087
1177 1162873 1163148 276 + 60         Phage transcriptional regulator cro locus|Amico_1144, protein_id|YP_003553991.1, gi|294102133, geneID|8964088
1178 1163385 1163717 333 + 236     1: 1   hypothetical protein locus|Amico_1145, protein_id|YP_003553992.1, gi|294102134, geneID|8964089
1179 1163794 1164873 1080 + 76         beta-lactamase-like protein locus|Amico_1146, protein_id|YP_003553993.1, gi|294102135, InterPro:IPR005135, geneID|8964090
1180 1164993 1166684 1692 + 119     1: 1   hypothetical protein locus|Amico_1147, protein_id|YP_003553994.1, gi|294102136, geneID|8964091

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
DHQS_phosphatase_fusion Thamm_Antje_user hypothetical protein


  Protein Sequence

>fig|572547.3.peg.1174 hypothetical protein
MCDWEKEKYPPTDAKNIAALEQTLGFETGYLYSILYGNPTPLRRKESSAASASIE

MD5 = 986724ec84dc5f2f6d9c569b62453d77


  DNA Sequence

>fig|572547.3.peg.1174 hypothetical protein
gtgtgtgattgggaaaaagaaaagtatcctcctacagatgctaaaaatatagctgcactt
gaacaaacacttggttttgagaccggatatctttactccattttatacggaaaccctaca
cccctccgcaggaaagagagctcagcggcttcagcttccatcgaataa


  DNA with Flanking Sequence

>fig|572547.3.peg.1174 hypothetical protein
gcaacagggattaggtcgtagtctttaaaaatgttgtcttttcctatttggattggatta
tctgtttcacccataaggtaggctatggaaacctcaaggcttctggaaagtttatgtaca
ttttctccagtagggaaatagcgatctttctcccaatctacaattgttgtcttcgcaact
ccgacgttatctgctagttgctgttgtgtccatccttttgccttacgtagacggcgtatt
tcttctcctgagatcatccgatcacctcctttatgtcaagtacaggctacttataaaatt
aaattaagtcaagacaagttatattgaatatattagttgcctacacttgacttttcacga
taattaatataatattcaagcagactagaacaaaaggaggtgaggatatgggatttggtg
aaataataaagacatctaggttgcgtatggggctaactcaagagggtttgagtagaaaag
tagggtgtacacgaactaccgtgtgtgattgggaaaaagaaaagtatcctcctacagatg
ctaaaaatatagctgcacttgaacaaacacttggttttgagaccggatatctttactcca
ttttatacggaaaccctacacccctccgcaggaaagagagctcagcggcttcagcttcca
tcgaataaatgatcttgcggaggcaatccaagcagttcagatactttataaaacctgtga
caccccggaagaggtaacagtaatatttcaagaccttttagcaaatggagaagcaaactc
agagaaaggtattcagtttataaacgctatatgcgctctcgggaagtacattgagattct
ttcaagaataaaagtaaagcgggcagaaaatatttaacactttttgttttttgagcgaca
tcagcacactgatataggtaggcaccttgacaattcggaggccgaaccgtttcaggcctg
caatagagagacggcataccgagcggaaggggagtagcgcgagttcgccatgaggcccct
acgatcgccaagatggtgtgcgataagagaagggagggggttgtggcgtgggcatagatg
agcacataaaaaagcttgtacaggtcgaagtgcagaaggctgtcagcgcggctgtttcaa
aactacagccggagcctccaactgaaaa


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search