The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on aspen.cels.anl.gov
The SEED


FIG search

Protein fig|572547.3.peg.1158: Aminobacterium colombiense DSM 12261

This feature in The SEED Viewer

NCBI Taxonomy Id: 572547

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NC_014011 from base 1146632 to 1157959 (11328 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1154 1148557 1146632 1926 -           Phage head, head-tail preconnector protease C / Phage head, scaffolding domain Nu3 locus|Amico_1120, protein_id|YP_003553968.1, gi|294102110, InterPro:IPR006433, geneID|8964064
1155 1150022 1148538 1485 - -20         Phage head, portal protein B locus|Amico_1121, protein_id|YP_003553969.1, gi|294102111, InterPro:IPR006429, geneID|8964065
1156 1150204 1150016 189 - -7         Phage head, head-tail joining protein W locus|Amico_1122, protein_id|YP_003553970.1, gi|294102112, geneID|8964066
1157 1152088 1150223 1866 - 18         Phage terminase, large subunit locus|Amico_1123, protein_id|YP_003553971.1, gi|294102113, InterPro:IPR008866, geneID|8964067
1158 1152605 1152081 525 - -8         hypothetical protein locus|Amico_1124, protein_id|YP_003553972.1, gi|294102114, geneID|8964068
1159 1153527 1152964 564 - 358         Phage integrase locus|Amico_1125, protein_id|YP_003553973.1, gi|294102115, InterPro:IPR002104, geneID|8964069
1160 1153772 1153569 204 - 41         hypothetical protein locus|Amico_1126, protein_id|YP_003553974.1, gi|294102116, geneID|8964070
1161 1154645 1154151 495 - 378         hypothetical protein locus|Amico_1127, protein_id|YP_003553975.1, gi|294102117, geneID|8964071
1162 1155028 1154837 192 - 191         hypothetical protein locus|Amico_1129, protein_id|YP_003553977.1, gi|294102119, geneID|8964073
1163 1155252 1155034 219 - 5         Two-component transcriptional response regulator, LuxR family  
1164 1156177 1155245 933 - -8         Phage DNA helicase loader locus|Amico_1131, protein_id|YP_003553978.1, gi|294102120, InterPro:IPR002611, InterPro:IPR003593, geneID|8964075
1165 1157043 1156174 870 - -4         hypothetical protein locus|Amico_1132, protein_id|YP_003553979.1, gi|294102121, geneID|8964076
1166 1157510 1157073 438 - 29     4: 4 1 2 3   Deoxyuridine 5'-triphosphate nucleotidohydrolase (EC 3.6.1.23) locus|Amico_1133, protein_id|YP_003553980.1, gi|294102122, InterPro:IPR008180, InterPro:IPR008181, geneID|8964077
1167 1157959 1157600 360 - 89         hypothetical protein locus|Amico_1134, protein_id|YP_003553981.1, gi|294102123, InterPro:IPR001589, geneID|8964078

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|572547.3.peg.1158 hypothetical protein
MPKANIKVLNDDEILLSTKRCSAFFGVSPKTLLEWRKMGCPQRSRGWWDPEAVLRWRTQV
TSKDGEVEEENWVALKTKADALYKQAKASQEEIRLQELKGLYMKKEEVYLEWANRLAVCK
ANMFTWSRTLAPIVIGRSLREIEKIIYDETYLLWEQYYREGPFTPRNAEGESVA

MD5 = d3879c06d580440300895d13e37e932e


  DNA Sequence

>fig|572547.3.peg.1158 hypothetical protein
atgccaaaagccaacattaaggttcttaatgatgatgaaatcttgctttcgacaaaacgc
tgttcggccttttttggcgtttcaccaaaaaccctgcttgaatggcgaaagatggggtgt
cctcaaagatctaggggatggtgggatcctgaagcagtgttgcgttggaggacgcaagta
acgtctaaagatggtgaagttgaagaagagaattgggtcgcattaaaaacaaaagcagat
gccttatataaacaggcaaaggcttcacaagaagaaattcggctgcaagagctgaagggt
ctttacatgaaaaaagaagaagtctatttggagtgggctaatagattagctgtttgcaag
gcaaatatgtttacatggtcacgtacacttgctcctatagtgattggtcgtagtttgcgc
gaaatagagaaaataatctacgacgaaacatatttactatgggaacaatactaccgagag
gggccgttcacacctcgaaacgcagagggtgagagcgttgcctaa


  DNA with Flanking Sequence

>fig|572547.3.peg.1158 hypothetical protein
ttataaaactacaaaagatatagctgccatacaagagatatatggccacaactcagcaaa
ggacacgcttcgctacatttgcgttgatcaagtccagaaggattttatctatgaaagtgt
taccttccagggaattaaataagcgatataaataagttttttaataaacgcaaaattaag
gcatttataactggcaacaaagcctgtgttcatgcggctcgaagttgtagttggcgaatg
ttacagaacataagttatgtcagattcatataagaggacttctgaaactttaaggccttc
gtaaagcccgttgttgagcaggtttagggggttttgggtccttcctggagaaaaagacta
aggcgggtaaccgaccgcgatgattcccttggtaaaattatgaaaaaggggttaaatgta
aaacaacgataacttaatcattaaatatttttagggtcattaaactaaagtttacagttg
ggtggaggtgtacaaataaaatgccaaaagccaacattaaggttcttaatgatgatgaaa
tcttgctttcgacaaaacgctgttcggccttttttggcgtttcaccaaaaaccctgcttg
aatggcgaaagatggggtgtcctcaaagatctaggggatggtgggatcctgaagcagtgt
tgcgttggaggacgcaagtaacgtctaaagatggtgaagttgaagaagagaattgggtcg
cattaaaaacaaaagcagatgccttatataaacaggcaaaggcttcacaagaagaaattc
ggctgcaagagctgaagggtctttacatgaaaaaagaagaagtctatttggagtgggcta
atagattagctgtttgcaaggcaaatatgtttacatggtcacgtacacttgctcctatag
tgattggtcgtagtttgcgcgaaatagagaaaataatctacgacgaaacatatttactat
gggaacaatactaccgagaggggccgttcacacctcgaaacgcagagggtgagagcgttg
cctaattggtcatatcaagaattatcagtagctcggccccctgaacgaatgacggtttcg
gaatgggcagaccgttttagggttttagatcgccgaatatctgctaagccaggaccgtgg
cgcactagctttactccatatttgaaagatgttatggattactggaccaatccagaaata
gaagaaatagtgatctgtaaagcagcccaaagcggcggtactgaagccgctctaaattgc
ttaggatattcaatagaccaagatccaagctccgcactaatcgtttacccttctcttgaa
attgcggagtggacgagtgaaaatcgtattcagccgatggttgaagcctcagctcggctg
cgtgagaagtatttgcatcatgaatcagatcgcttggagctgcagttcccaggaatgtac
ctcgtgttggccggcgcaaatagtgctgcaagtttggctagccggccagttagatatctt
atcttcgatgaaattgataaatacc


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search