The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|565663.4.peg.1432: Enterococcus faecium Com15

This feature in The SEED Viewer

NCBI Taxonomy Id: 565663

Current Assignment: NtrC family Transcriptional regulator, ATPase domain
Translate Function Assignments



Context on contig NZ_GG670326 from base 170335 to 184071 (13737 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
rna.26 170408 170335 74 -           tRNA-Arg-CCT  
1424 170562 170726 165 + 153         FIG00627422: hypothetical protein  
1425 171979 170798 1182 - 71         conserved hypothetical protein  
1426 172516 172103 414 - 123         DNA-directed RNA polymerase specialized sigma subunit, sigma24-like  
1427 172698 172516 183 - -1         FIG00629913: hypothetical protein  
1428 172951 172730 222 - 31         FIG00628773: hypothetical protein  
1429 174479 173019 1461 - 67         PTS system, cellobiose-specific IIC component (EC 2.7.1.69)  
1430 174907 174587 321 - 107 8     PTS system, cellobiose-specific IIA component (EC 2.7.1.69)  
1431 175253 174936 318 - 28 5     PTS system, cellobiose-specific IIB component (EC 2.7.1.69)  
1432 178107 175405 2703 - 151       NtrC family Transcriptional regulator, ATPase domain  
1433 179447 178170 1278 - 62     1: 6   ATP-dependent RNA helicase YfmL  
1434 180460 179447 1014 - -1         oxidoreductase, Gfo/Idh/MocA family  
1435 181204 180476 729 - 15     4: 9 1 7 10   Sugar/maltose fermentation stimulation protein homolog  
1436 181380 181709 330 + 175         conserved hypothetical protein  
1437 181883 182530 648 + 173         Mn-dependent transcriptional regulator MntR  
1438 182545 184071 1527 + 14     5: 5 2 4 8 3   Glucose-6-phosphate 1-dehydrogenase (EC 1.1.1.49)  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|565663.4.peg.1432 NtrC family Transcriptional regulator, ATPase domain
MKERQEEILHLLTENQQGLTASDVAERLNIDRSNASRYLSELYKAHHIVKTAGRPVVYSL
PTEKSKSDEVHVDSSTQVTFETLVGENDSLKVSIQQAKAAILYPPRGLHTIIFGETGTGK
SMFAECMYHFAIESEMLSADAPFVSFNCADYAQNPQLLFGHIFGIKKGAYTGAAQDSPGL
IAKADGGILFLDEIHRLPPEGQEMLFTFIDKGIYRPLGESAQVHEASVQIIGATTESSES
FLTTFNRRIPMAITLPNLASRSLDERYEIISLFIKQEANRLNQRIDIEKEAILAFMLYDA
EGNIGQVKRDLKLVCAKSFLHYRTHHEKKLIIRKEELSLQVQKGLLKIKEIPERLDRFMD
SKSQYLTFEPGFADVVWSQDPERNMQVYNDIEEKVTSLSETGVENIDLETLISKDVDAYF
QTYVKELTKSSIPKDLLPDEIWRLTNQLYDVAEKRLDRIYNEKARFAFALHLQSTLDRVR
EGHMIVHPDLNNVRKNFKREFQVAIDLSTIIEEEEQVEIPFDEIGFISMFLSINLGESEP
VKENKVDVLVLMHGRQTASSMLEMAQELLGTKVGKAFNMPLVMEVQTMYEEVLQYVKNYQ
GHLTNGLLLLTDMGSLNTFSDLIYEETGIRTKAITMTSTMIVIEAIRMASVGRSLEEIYQ
NIQLSFESIVRDQFKAEKSETLQRKKAVIVTCFTGEGVAAKLYQRIMPVINQDKVELIQM
QFLERESFKKHIDALLEEYEIKAIAGTVDVDYQNIPFFSAYDVFDDEKLNVLKRIADDEI
PTAKIVDSLSGSLSDVFSIDELIRSLQKTVQQIQTDLSIIVEPGVDTGIVIHLAFMLDGL
IKKETHRQFEKLSIFSKIYRLEMDIIRANLMALERKYQVKISEDDIAFLTQMFLENKIKK

MD5 = 032b2dc8e4d1e941801f44b7d86f392e


  DNA Sequence

>fig|565663.4.peg.1432 NtrC family Transcriptional regulator, ATPase domain
gtgaaagaacgtcaagaagagatcttgcatctattgacagaaaaccaacaaggattgaca
gcaagtgatgtagctgagcgcttgaatattgatcgaagcaatgcaagccgatatttaagc
gaactgtataaggctcatcatattgtaaaaaccgctggccgaccagtcgtttactccttg
ccaacggaaaaatcaaaatctgatgaagtacatgtcgactcttctacgcaagtgactttt
gaaacgctcgttggagaaaatgattctttaaaagtcagcatacagcaggcaaaagcagcg
attctttatccgccgcgggggctgcataccattatttttggagaaactggtacagggaag
tcgatgtttgcggaatgtatgtatcattttgcaatcgaatctgaaatgctttcagccgat
gcgccatttgtttctttcaattgtgcggattatgctcaaaatccccaactgctctttgga
cacatctttgggatcaaaaaaggggcttacacaggagcagcgcaagacagtcctggtcta
atcgccaaagcagacggcggtatattgtttttagatgagatccaccgtttaccaccggaa
gggcaggaaatgctgtttactttcatcgataaaggtatctatcgtccacttggagaaagt
gcacaagtacatgaagcatcagttcagatcattggggcaacgactgaatcttcagaaagc
ttcttgactaccttcaaccgacggatccctatggctatcaccttgccaaaccttgcttcg
cgttcattggatgagcgttatgagatcatctctctttttatcaaacaagaagcgaaccgt
ttgaatcaacgtatcgatatcgaaaaagaagcgattcttgccttcatgctttatgatgcg
gaagggaatatcggtcaagtgaaacgagacctgaaattagtctgtgcaaaatctttttta
cattaccgaacgcatcatgagaaaaagctgatcattcgaaaagaagaactttcccttcaa
gtacaaaaaggactactgaaaatcaaggaaataccagaacgcctcgaccgattcatggac
agtaagagccagtatttgacatttgaaccagggtttgctgatgtcgtctggtcacaagat
ccagaaagaaacatgcaagtctacaacgatattgaggaaaaagttacttctctttctgaa
accggtgtggagaacatcgatttggagacgctcatttcaaaagatgtagatgcttatttt
cagacatatgtcaaagaattgactaaaagttcaatcccgaaagatcttttgccagatgaa
atctggcggttaaccaatcaattgtatgatgtggctgaaaaacggttagaccgtatttat
aatgaaaaagctcgttttgcttttgctttgcatttgcaaagtacattggatcgtgtgaga
gaaggacatatgattgtccatccagatttgaataacgtacgaaaaaattttaagagggaa
ttccaggtagcaatcgatctttcgacaatcattgaagaagaagaacaagtcgagattcct
tttgatgaaattggctttatcagtatgtttctttctatcaatttaggagaaagtgagccc
gttaaagaaaacaaagtagatgttcttgtactgatgcacggcagacagaccgcttcaagt
atgttggagatggcgcaagaactattaggaacaaaagtagggaaagcttttaatatgcca
ctggttatggaagttcaaacaatgtatgaagaggtcctacaatatgtcaaaaattatcag
gggcatttgacgaatggcttgcttttgttaacagatatgggatcattaaacaccttcagt
gatttgatttatgaagagactggcattcggacgaaagctatcacaatgacaagtacgatg
attgtgatagaagcgatacggatggcaagtgttggaagaagcttagaagaaatctatcaa
aatattcagctctcctttgaatcaatcgtacgtgatcagttcaaagcggaaaaatctgaa
actttacagcgtaaaaaagccgtcatcgtgacatgttttactggtgagggagtagctgcc
aaattgtatcaacggattatgccggtgattaatcaagacaaagtagaactgatccagatg
cagtttttagaacgcgaatcattcaaaaaacacattgatgccttattggaagaatacgag
atcaaagcaattgcaggaacggttgacgttgattatcaaaatatcccatttttttccgcc
tatgacgtttttgatgatgaaaaattgaatgttttaaagcgtatagctgatgatgagatt
ccaacagctaaaattgttgattcgctttcaggatcattaagtgatgtcttttctattgat
gaattaatccgctcattgcaaaaaacagttcagcagatccagacagatttgtcgattatc
gtagaaccaggagtagatactggaattgtcatccatttagccttcatgctagacggattg
atcaaaaaagaaacgcatcggcaatttgagaaactatctattttctcaaaaatttaccgt
ttggaaatggatatcattcgagcaaacttgatggcactggaacggaaatatcaggtaaaa
atttcagaagatgatatcgcgtttcttacacaaatgtttcttgaaaacaaaataaaaaaa
taa


  DNA with Flanking Sequence

>fig|565663.4.peg.1432 NtrC family Transcriptional regulator, ATPase domain
gaacaattcaaaaagaaaaagatcagcgcacttttgaccacagatgtggcggctagaggt
ttagatattacaggacttccttatgtcgtgaatgcagaagtgccgttaagtgaagaagct
tacttgcatcgttctggaagaactggtcgaatgggcaatgaaggaacagtgatcacactc
gtacaagataacaatttaagagatttgaaacgacttttacgtccgacaaacataacactt
gaagagatttttctgcacggaggaaagttacaaacggatcaaccaatcaaagaagatgta
gctaccgcagcgaataacaagtataagaaatcttttcctgggaaagaacaaaatccagag
cataacaaaaacaaatcaagaaaaaaagttaaaaataaatcaaaaaaagagagaaataaa
ggagcaaggcgcaaataagcgcctttttatgctatgattatgaaaacgggaacaaaattg
gttgccagaggagggattatgtgaaagaacgtcaagaagagatcttgcatctattgacag
aaaaccaacaaggattgacagcaagtgatgtagctgagcgcttgaatattgatcgaagca
atgcaagccgatatttaagcgaactgtataaggctcatcatattgtaaaaaccgctggcc
gaccagtcgtttactccttgccaacggaaaaatcaaaatctgatgaagtacatgtcgact
cttctacgcaagtgacttttgaaacgctcgttggagaaaatgattctttaaaagtcagca
tacagcaggcaaaagcagcgattctttatccgccgcgggggctgcataccattatttttg
gagaaactggtacagggaagtcgatgtttgcggaatgtatgtatcattttgcaatcgaat
ctgaaatgctttcagccgatgcgccatttgtttctttcaattgtgcggattatgctcaaa
atccccaactgctctttggacacatctttgggatcaaaaaaggggcttacacaggagcag
cgcaagacagtcctggtctaatcgccaaagcagacggcggtatattgtttttagatgaga
tccaccgtttaccaccggaagggcaggaaatgctgtttactttcatcgataaaggtatct
atcgtccacttggagaaagtgcacaagtacatgaagcatcagttcagatcattggggcaa
cgactgaatcttcagaaagcttcttgactaccttcaaccgacggatccctatggctatca
ccttgccaaaccttgcttcgcgttcattggatgagcgttatgagatcatctctcttttta
tcaaacaagaagcgaaccgtttgaatcaacgtatcgatatcgaaaaagaagcgattcttg
ccttcatgctttatgatgcggaagggaatatcggtcaagtgaaacgagacctgaaattag
tctgtgcaaaatcttttttacattaccgaacgcatcatgagaaaaagctgatcattcgaa
aagaagaactttcccttcaagtacaaaaaggactactgaaaatcaaggaaataccagaac
gcctcgaccgattcatggacagtaagagccagtatttgacatttgaaccagggtttgctg
atgtcgtctggtcacaagatccagaaagaaacatgcaagtctacaacgatattgaggaaa
aagttacttctctttctgaaaccggtgtggagaacatcgatttggagacgctcatttcaa
aagatgtagatgcttattttcagacatatgtcaaagaattgactaaaagttcaatcccga
aagatcttttgccagatgaaatctggcggttaaccaatcaattgtatgatgtggctgaaa
aacggttagaccgtatttataatgaaaaagctcgttttgcttttgctttgcatttgcaaa
gtacattggatcgtgtgagagaaggacatatgattgtccatccagatttgaataacgtac
gaaaaaattttaagagggaattccaggtagcaatcgatctttcgacaatcattgaagaag
aagaacaagtcgagattccttttgatgaaattggctttatcagtatgtttctttctatca
atttaggagaaagtgagcccgttaaagaaaacaaagtagatgttcttgtactgatgcacg
gcagacagaccgcttcaagtatgttggagatggcgcaagaactattaggaacaaaagtag
ggaaagcttttaatatgccactggttatggaagttcaaacaatgtatgaagaggtcctac
aatatgtcaaaaattatcaggggcatttgacgaatggcttgcttttgttaacagatatgg
gatcattaaacaccttcagtgatttgatttatgaagagactggcattcggacgaaagcta
tcacaatgacaagtacgatgattgtgatagaagcgatacggatggcaagtgttggaagaa
gcttagaagaaatctatcaaaatattcagctctcctttgaatcaatcgtacgtgatcagt
tcaaagcggaaaaatctgaaactttacagcgtaaaaaagccgtcatcgtgacatgtttta
ctggtgagggagtagctgccaaattgtatcaacggattatgccggtgattaatcaagaca
aagtagaactgatccagatgcagtttttagaacgcgaatcattcaaaaaacacattgatg
ccttattggaagaatacgagatcaaagcaattgcaggaacggttgacgttgattatcaaa
atatcccatttttttccgcctatgacgtttttgatgatgaaaaattgaatgttttaaagc
gtatagctgatgatgagattccaacagctaaaattgttgattcgctttcaggatcattaa
gtgatgtcttttctattgatgaattaatccgctcattgcaaaaaacagttcagcagatcc
agacagatttgtcgattatcgtagaaccaggagtagatactggaattgtcatccatttag
ccttcatgctagacggattgatcaaaaaagaaacgcatcggcaatttgagaaactatcta
ttttctcaaaaatttaccgtttggaaatggatatcattcgagcaaacttgatggcactgg
aacggaaatatcaggtaaaaatttcagaagatgatatcgcgtttcttacacaaatgtttc
ttgaaaacaaaataaaaaaataaacacactaatcatactgtttacacactggatatcagt
gtgcgcactatataaaagagctaaaaagcatgaaaacgctattttagctctttttttctt
ggcatgcttcttgcattatataaaagtgtaaaaacaataaaaggagtgttaaaaatggca
aaaaaaacaattatgttagtttgttcagcagggatgagtacgagtttattggtcacaaaa
atgcaaaaagcagcggaagaaaaaggaatggaagctgatatttttgctgtttctgcctca
gatgcagataataatttagaatctaagaatgtcgatgttttattattaggtcctcaagta
cgtttcatgaaagctcaattcgaacaaaaacttgcgcctaaaggtattccgttagatgtc
atcaatatgcaggactatggcatgatgaatggagaaaaagtacttgcacaagcagaaaat
ctaatgaaataaatcaagtatgcagttgggggataacaacgtg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
gb|EEV62107.1 Enterococcus faecium Com15     transcriptional antiterminator bglG/Sigma-54 factor
gi|257837033 Enterococcus faecium Com15 NCBI   transcriptional antiterminator bglG/Sigma-54 factor
gi|257899121 Enterococcus faecium Com15 NCBI   transcriptional antiterminator bglG/Sigma-54 factor
ref|ZP_05678774.1 Enterococcus faecium Com15 RefSeq   transcriptional antiterminator bglG/Sigma-54 factor


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
8 fig|565663.4.peg.1430 PTS system, cellobiose-specific IIA component (EC 2.7.1.69)
5 fig|565663.4.peg.1431 PTS system, cellobiose-specific IIB component (EC 2.7.1.69)


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search