The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|565663.4.peg.1431: Enterococcus faecium Com15

This feature in The SEED Viewer

NCBI Taxonomy Id: 565663

Current Assignment: PTS system, cellobiose-specific IIB component (EC 2.7.1.69)
Translate Function Assignments



Context on contig NZ_GG670326 from base 169127 to 180460 (11334 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1423 169127 170266 1140 +           Phage integrase  
rna.26 170408 170335 74 - 68         tRNA-Arg-CCT  
1424 170562 170726 165 + 153         FIG00627422: hypothetical protein  
1425 171979 170798 1182 - 71         conserved hypothetical protein  
1426 172516 172103 414 - 123         DNA-directed RNA polymerase specialized sigma subunit, sigma24-like  
1427 172698 172516 183 - -1         FIG00629913: hypothetical protein  
1428 172951 172730 222 - 31         FIG00628773: hypothetical protein  
1429 174479 173019 1461 - 67 10     PTS system, cellobiose-specific IIC component (EC 2.7.1.69)  
1430 174907 174587 321 - 107 25     PTS system, cellobiose-specific IIA component (EC 2.7.1.69)  
1431 175253 174936 318 - 28       PTS system, cellobiose-specific IIB component (EC 2.7.1.69)  
1432 178107 175405 2703 - 151 5     NtrC family Transcriptional regulator, ATPase domain  
1433 179447 178170 1278 - 62     1: 1   ATP-dependent RNA helicase YfmL  
1434 180460 179447 1014 - -1         oxidoreductase, Gfo/Idh/MocA family  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|565663.4.peg.1431 PTS system, cellobiose-specific IIB component (EC 2.7.1.69)
MAKKTIMLVCSAGMSTSLLVTKMQKAAEEKGMEADIFAVSASDADNNLESKNVDVLLLGP
QVRFMKAQFEQKLAPKGIPLDVINMQDYGMMNGEKVLAQAENLMK

MD5 = 084ca4fa6a25f97f1642fb8df26eb5bb


  DNA Sequence

>fig|565663.4.peg.1431 PTS system, cellobiose-specific IIB component (EC 2.7.1.69)
atggcaaaaaaaacaattatgttagtttgttcagcagggatgagtacgagtttattggtc
acaaaaatgcaaaaagcagcggaagaaaaaggaatggaagctgatatttttgctgtttct
gcctcagatgcagataataatttagaatctaagaatgtcgatgttttattattaggtcct
caagtacgtttcatgaaagctcaattcgaacaaaaacttgcgcctaaaggtattccgtta
gatgtcatcaatatgcaggactatggcatgatgaatggagaaaaagtacttgcacaagca
gaaaatctaatgaaataa


  DNA with Flanking Sequence

>fig|565663.4.peg.1431 PTS system, cellobiose-specific IIB component (EC 2.7.1.69)
tgttgattcgctttcaggatcattaagtgatgtcttttctattgatgaattaatccgctc
attgcaaaaaacagttcagcagatccagacagatttgtcgattatcgtagaaccaggagt
agatactggaattgtcatccatttagccttcatgctagacggattgatcaaaaaagaaac
gcatcggcaatttgagaaactatctattttctcaaaaatttaccgtttggaaatggatat
cattcgagcaaacttgatggcactggaacggaaatatcaggtaaaaatttcagaagatga
tatcgcgtttcttacacaaatgtttcttgaaaacaaaataaaaaaataaacacactaatc
atactgtttacacactggatatcagtgtgcgcactatataaaagagctaaaaagcatgaa
aacgctattttagctctttttttcttggcatgcttcttgcattatataaaagtgtaaaaa
caataaaaggagtgttaaaaatggcaaaaaaaacaattatgttagtttgttcagcaggga
tgagtacgagtttattggtcacaaaaatgcaaaaagcagcggaagaaaaaggaatggaag
ctgatatttttgctgtttctgcctcagatgcagataataatttagaatctaagaatgtcg
atgttttattattaggtcctcaagtacgtttcatgaaagctcaattcgaacaaaaacttg
cgcctaaaggtattccgttagatgtcatcaatatgcaggactatggcatgatgaatggag
aaaaagtacttgcacaagcagaaaatctaatgaaataaatcaagtatgcagttgggggat
aacaacgtggaagatcaacaaaatctagaagccatcatgggactcatcatgtttggcggt
aatgcaaagagcgacgcaatggaagcgattgcggctgctaaaatcggtgatttcgagtta
gcggatagaaaaatcgctgatgcagaagaatcacttatacaagcacatcatgcacaaaca
gacatgttgacacaagaagcacaaggaaatcatatgcaagtgacgttattgactgttcat
agtcaagatcatttaatgacgtctattgcgtttactgatttagcaaaagaaatcatcgaa
ctttatcgtcgcgtatacagcgaataaatacaacttcttttttgaacggaagaagaaaaa
tttttgaacggattttttattttgttataaaaagaactctctttatataaaaaacttata
ggaggaagtaaaaaatgaacggactaacaagttggatggagaaatacatcctgccggt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005351       F:sugar:hydrogen symporter activity
GO:0008982       F:protein-N(PI)-phosphohistidine-sugar phosph...
GO:0009401       P:phosphoenolpyruvate-dependent sugar phospho...
fig|333849.6.peg.4306 Enterococcus faecium DO FIG   PTS system, cellobiose-specific IIB component (EC 2.7.1.69)
fig|333849.6.peg.508 Enterococcus faecium DO FIG   PTS system, cellobiose-specific IIB component (EC 2.7.1.69)
fig|525279.3.peg.2374 Enterococcus faecium TX1330 FIG   PTS system, cellobiose-specific IIB component (EC 2.7.1.69)
fig|529885.3.peg.1418 Enterococcus faecium E980 FIG   PTS system, cellobiose-specific IIB component (EC 2.7.1.69)
fig|535205.4.peg.981 Enterococcus faecium E1071 FIG   PTS system, cellobiose-specific IIB component (EC 2.7.1.69)
fig|535206.4.peg.1058 Enterococcus faecium E1162 FIG   PTS system, cellobiose-specific IIB component (EC 2.7.1.69)
fig|544875.4.peg.748 Enterococcus faecium E1636 FIG   PTS system, cellobiose-specific IIB component (EC 2.7.1.69)
fig|546340.3.peg.1638 Enterococcus faecium E1679 FIG   PTS system, cellobiose-specific IIB component (EC 2.7.1.69)
fig|547468.4.peg.953 Enterococcus faecium U0317 FIG   PTS system, cellobiose-specific IIB component (EC 2.7.1.69)
fig|565656.3.peg.1290 Enterococcus faecium 1,230,933 FIG   PTS system, cellobiose-specific IIB component (EC 2.7.1.69)
fig|565657.5.peg.888 Enterococcus faecium 1,231,502 FIG   PTS system, cellobiose-specific IIB component (EC 2.7.1.69)
fig|565658.4.peg.1458 Enterococcus faecium 1,231,501 FIG   PTS system, cellobiose-specific IIB component (EC 2.7.1.69)
fig|565659.3.peg.2007 Enterococcus faecium 1,141,733 FIG   PTS system, cellobiose-specific IIB component (EC 2.7.1.69)
fig|565660.4.peg.770 Enterococcus faecium 1,231,410 FIG   PTS system, cellobiose-specific IIB component (EC 2.7.1.69)
fig|565661.4.peg.1483 Enterococcus faecium 1,231,408 FIG   PTS system, cellobiose-specific IIB component (EC 2.7.1.69)
fig|565662.4.peg.2032 Enterococcus faecium Com12 FIG   PTS system, cellobiose-specific IIB component (EC 2.7.1.69)
fig|565664.3.peg.625 Enterococcus faecium C68 FIG   PTS system, cellobiose-specific IIB component (EC 2.7.1.69)
fig|645663.4.peg.560 Enterococcus faecium E1039 FIG   PTS system, cellobiose-specific IIB component (EC 2.7.1.69)
fig|702448.3.peg.353 Enterococcus faecalis PC1.1 FIG   PTS system, cellobiose-specific IIB component (EC 2.7.1.69)
gb|EAN10717.1 Enterococcus faecium DO     Phosphotransferase system, lactose/cellobiose-specific IIB subunit
gb|EEV42370.1 Enterococcus faecium 1,230,933     phosphotransferase system protein
gb|EEV44736.1 Enterococcus faecium 1,231,502     phosphotransferase system protein
gb|EEV48182.1 Enterococcus faecium 1,231,501     phosphotransferase system protein
gb|EEV51489.1 Enterococcus faecium 1,141,733     phosphotransferase system protein
gb|EEV53196.1 Enterococcus faecium 1,231,410     phosphotransferase system protein
gb|EEV56524.1 Enterococcus faecium 1,231,408     phosphotransferase system protein
gb|EEV60108.1 Enterococcus faecium Com12     phosphotransferase system protein
gb|EEV62106.1 Enterococcus faecium Com15     phosphotransferase system protein
gi|257813612 Enterococcus faecium 1,230,933 NCBI   phosphotransferase system protein
gi|257817408 Enterococcus faecium 1,231,502 NCBI   phosphotransferase system protein
gi|257821048 Enterococcus faecium 1,231,501 NCBI   phosphotransferase system protein
gi|257824557 Enterococcus faecium 1,141,733 NCBI   phosphotransferase system protein
gi|257826570 Enterococcus faecium 1,231,410 NCBI   phosphotransferase system protein
gi|257829917 Enterococcus faecium 1,231,408 NCBI   phosphotransferase system protein
gi|257833687 Enterococcus faecium Com12 NCBI   phosphotransferase system protein
gi|257837032 Enterococcus faecium Com15 NCBI   phosphotransferase system protein
gi|257879384 Enterococcus faecium 1,230,933 NCBI   phosphotransferase system protein
gi|257881750 Enterococcus faecium 1,231,502 NCBI   phosphotransferase system protein
gi|257885196 Enterococcus faecium 1,231,501 NCBI   phosphotransferase system protein
gi|257888503 Enterococcus faecium 1,141,733 NCBI   phosphotransferase system protein
gi|257890210 Enterococcus faecium 1,231,410 NCBI   phosphotransferase system protein
gi|257893538 Enterococcus faecium 1,231,408 NCBI   phosphotransferase system protein
gi|257897122 Enterococcus faecium Com12 NCBI   phosphotransferase system protein
gi|257899120 Enterococcus faecium Com15 NCBI   phosphotransferase system protein
gi|258615794 Enterococcus faecium DO NCBI   PTS system, IIB component
gi|68196288 Enterococcus faecium DO NCBI   Phosphotransferase system, lactose/cellobiose-specific IIB subunit
gi|69244697 Enterococcus faecium DO NCBI   Phosphotransferase system, lactose/cellobiose-specific IIB subunit
img|638350837 Enterococcus faecium DO IMG   Phosphotransferase system, lactose/cellobiose-specific IIB subunit
ref|ZP_00602961.1 Enterococcus faecium DO RefSeq   Phosphotransferase system, lactose/cellobiose-specific IIB subunit
ref|ZP_05659037.1 Enterococcus faecium 1,230,933 RefSeq   phosphotransferase system protein
ref|ZP_05661403.1 Enterococcus faecium 1,231,502 RefSeq   phosphotransferase system protein
ref|ZP_05664849.1 Enterococcus faecium 1,231,501 RefSeq   phosphotransferase system protein
ref|ZP_05668156.1 Enterococcus faecium 1,141,733 RefSeq   phosphotransferase system protein
ref|ZP_05669863.1 Enterococcus faecium 1,231,410 RefSeq   phosphotransferase system protein
ref|ZP_05673191.1 Enterococcus faecium 1,231,408 RefSeq   phosphotransferase system protein
ref|ZP_05676775.1 Enterococcus faecium Com12 RefSeq   phosphotransferase system protein
ref|ZP_05678773.1 Enterococcus faecium Com15 RefSeq   phosphotransferase system protein
ref|ZP_05713564.1 Enterococcus faecium DO RefSeq   PTS system, IIB component
tr|Q3Y2J5 Enterococcus faecium DO TrEMBL   Phosphotransferase system, lactose/cellobiose-specific IIB subunit precursor


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
10 fig|565663.4.peg.1429 PTS system, cellobiose-specific IIC component (EC 2.7.1.69)
25 fig|565663.4.peg.1430 PTS system, cellobiose-specific IIA component (EC 2.7.1.69)
5 fig|565663.4.peg.1432 NtrC family Transcriptional regulator, ATPase domain


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search