The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|565663.4.peg.1429: Enterococcus faecium Com15

This feature in The SEED Viewer

NCBI Taxonomy Id: 565663

Current Assignment: PTS system, cellobiose-specific IIC component (EC 2.7.1.69)
Translate Function Assignments



Context on contig NZ_GG670326 from base 167577 to 180460 (12884 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1421 167577 168230 654 +           hypothetical protein  
1422 168367 169017 651 + 136         Hypothetical secreted protein  
1423 169127 170266 1140 + 109         Phage integrase  
rna.26 170408 170335 74 - 68         tRNA-Arg-CCT  
1424 170562 170726 165 + 153         FIG00627422: hypothetical protein  
1425 171979 170798 1182 - 71         conserved hypothetical protein  
1426 172516 172103 414 - 123 4     DNA-directed RNA polymerase specialized sigma subunit, sigma24-like  
1427 172698 172516 183 - -1         FIG00629913: hypothetical protein  
1428 172951 172730 222 - 31         FIG00628773: hypothetical protein  
1429 174479 173019 1461 - 67       PTS system, cellobiose-specific IIC component (EC 2.7.1.69)  
1430 174907 174587 321 - 107 11     PTS system, cellobiose-specific IIA component (EC 2.7.1.69)  
1431 175253 174936 318 - 28 12     PTS system, cellobiose-specific IIB component (EC 2.7.1.69)  
1432 178107 175405 2703 - 151         NtrC family Transcriptional regulator, ATPase domain  
1433 179447 178170 1278 - 62 4 1: 1   ATP-dependent RNA helicase YfmL  
1434 180460 179447 1014 - -1         oxidoreductase, Gfo/Idh/MocA family  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|565663.4.peg.1429 PTS system, cellobiose-specific IIC component (EC 2.7.1.69)
MNGLTSWMEKYILPVAAKIGAQKHLVALRDAFIGTLPATMAGSVAVMINAIIRDLPQQFN
STYADSLAADKGIFAVLNVIIGINGFVWNGTLAIAGLIFAFSWGYNLARAYGVNDLAGGI
VGLATLIQGISFGPALSAALDVNVPSNVADAINSSEIGATIADGTLSVGLWGWLKLDHLN
GNAYFTVMIMGAISVIIFCKLMLANITIKMPDSVPPAVSKAFAAILPATIALYVIAIINY
IVGRVADGQLIIDLVQKYIAEPFLGLSQGLGAVLIVTVFVQVFWFFGIHGPNVLAPVLEG
IWGQAQLINIDIFQKGYNGKTGTPAVLDAIEDGKAYMWVRGSFDAFAWFGGSGGTIVLLI
AILIFSKRADYLTVAKLSIGPGIFNINEPVMFGLPIVLNAIMFIPFLIAPVVATAIGWLA
TYFGLVAPVSQQVTWVVPPFLLSFLATGADWRAPIVTLVCMVVTFLIWAPFVISANKMDP
AAGEQQ

MD5 = 5fde2701e7afbad69efba62eef34e912


  DNA Sequence

>fig|565663.4.peg.1429 PTS system, cellobiose-specific IIC component (EC 2.7.1.69)
atgaacggactaacaagttggatggagaaatacatcctgccggttgccgcaaaaatcgga
gcgcaaaaacatttagttgctttgcgtgatgcttttatcggcacactgcccgcaacaatg
gcgggatcagtcgctgtaatgatcaatgcaattattcgagatttaccgcaacagtttaac
agtacctacgctgacagtttagcagcagacaaaggaatctttgccgtattgaatgtcatc
atcggaatcaatggttttgtctggaacggtacactagcaatcgccggattgatttttgcc
ttttcttgggggtataatcttgcccgagcttatggagtaaatgatctagctggggggatc
gttggtctagctaccttgattcaaggtatttcctttggtccagcattatcagcagcatta
gatgtgaatgtcccttcaaatgtcgcagatgcaatcaatagttctgagattggtgcaacg
attgcagatggcacactgtcagttggattatggggttggctgaaactagatcatttgaat
ggaaacgcttattttacagttatgatcatgggggcaatttcagtcattattttttgtaaa
ttgatgcttgctaacattacgatcaaaatgcctgattcagtaccaccagcagtatctaaa
gcatttgcagccattttaccagcgacgatcgctttatacgtcattgctattatcaattat
atcgtaggtcgtgtagctgatgggcaactaatcatcgatttggtgcaaaaatatattgca
gaaccattcctaggattatcccaagggttgggagcagtattgatcgtcacagtgtttgtt
caagtattctggttctttggtattcatggaccaaatgtattggcaccagtgctagaggga
atctggggacaagcacaactaatcaatattgatattttccaaaaaggttataacggaaaa
actggtacaccagccgtgttagacgcaatcgaagatggaaaagcttatatgtgggtccgt
ggatcgttcgatgcttttgcatggtttggcggatcaggtggaacgatcgtcttactgata
gctatcttgattttctctaaacgagcggattatttaacagtagctaaattatccattgga
cctggtattttcaatatcaacgagccagtgatgtttggtctgccgatcgtattgaatgcc
atcatgttcatcccattcttgattgctccagtagttgcgacagctatcggttggttagca
acttactttggacttgtagcaccagtttcgcaacaagttacatgggtagtaccgccgttc
ttattgtcattcttagcaacaggagcggattggcgagcaccaatcgtaacgttggtatgt
atggtcgtgactttcttgatttgggcaccgtttgtcatttctgcaaacaaaatggaccct
gccgcaggcgaacaacaataa


  DNA with Flanking Sequence

>fig|565663.4.peg.1429 PTS system, cellobiose-specific IIC component (EC 2.7.1.69)
atggagaaaaagtacttgcacaagcagaaaatctaatgaaataaatcaagtatgcagttg
ggggataacaacgtggaagatcaacaaaatctagaagccatcatgggactcatcatgttt
ggcggtaatgcaaagagcgacgcaatggaagcgattgcggctgctaaaatcggtgatttc
gagttagcggatagaaaaatcgctgatgcagaagaatcacttatacaagcacatcatgca
caaacagacatgttgacacaagaagcacaaggaaatcatatgcaagtgacgttattgact
gttcatagtcaagatcatttaatgacgtctattgcgtttactgatttagcaaaagaaatc
atcgaactttatcgtcgcgtatacagcgaataaatacaacttcttttttgaacggaagaa
gaaaaatttttgaacggattttttattttgttataaaaagaactctctttatataaaaaa
cttataggaggaagtaaaaaatgaacggactaacaagttggatggagaaatacatcctgc
cggttgccgcaaaaatcggagcgcaaaaacatttagttgctttgcgtgatgcttttatcg
gcacactgcccgcaacaatggcgggatcagtcgctgtaatgatcaatgcaattattcgag
atttaccgcaacagtttaacagtacctacgctgacagtttagcagcagacaaaggaatct
ttgccgtattgaatgtcatcatcggaatcaatggttttgtctggaacggtacactagcaa
tcgccggattgatttttgccttttcttgggggtataatcttgcccgagcttatggagtaa
atgatctagctggggggatcgttggtctagctaccttgattcaaggtatttcctttggtc
cagcattatcagcagcattagatgtgaatgtcccttcaaatgtcgcagatgcaatcaata
gttctgagattggtgcaacgattgcagatggcacactgtcagttggattatggggttggc
tgaaactagatcatttgaatggaaacgcttattttacagttatgatcatgggggcaattt
cagtcattattttttgtaaattgatgcttgctaacattacgatcaaaatgcctgattcag
taccaccagcagtatctaaagcatttgcagccattttaccagcgacgatcgctttatacg
tcattgctattatcaattatatcgtaggtcgtgtagctgatgggcaactaatcatcgatt
tggtgcaaaaatatattgcagaaccattcctaggattatcccaagggttgggagcagtat
tgatcgtcacagtgtttgttcaagtattctggttctttggtattcatggaccaaatgtat
tggcaccagtgctagagggaatctggggacaagcacaactaatcaatattgatattttcc
aaaaaggttataacggaaaaactggtacaccagccgtgttagacgcaatcgaagatggaa
aagcttatatgtgggtccgtggatcgttcgatgcttttgcatggtttggcggatcaggtg
gaacgatcgtcttactgatagctatcttgattttctctaaacgagcggattatttaacag
tagctaaattatccattggacctggtattttcaatatcaacgagccagtgatgtttggtc
tgccgatcgtattgaatgccatcatgttcatcccattcttgattgctccagtagttgcga
cagctatcggttggttagcaacttactttggacttgtagcaccagtttcgcaacaagtta
catgggtagtaccgccgttcttattgtcattcttagcaacaggagcggattggcgagcac
caatcgtaacgttggtatgtatggtcgtgactttcttgatttgggcaccgtttgtcattt
ctgcaaacaaaatggaccctgccgcaggcgaacaacaataagatgaatctgaggagcggg
acgctttaagtttcgttcctcataatgaattttcgaggaggaactgaaatgatttcaatt
gccagtgcaatgcaacaagatgcaatcaaagaattgttagaaggatacaatgaagaagga
atgacatttacgtttaaagaaaaacaaggaatcaaaatgttctttgaaacaagtgcagaa
gatccggaagctgcggctaaaaaagcaaaggaactaatcaaagcacagccttggggaaca
gtcctttattttcagtcaacagctgtttaagaaaatggttcaaaaagataggatggttga
tatgataaaaaacggtttatttttatgtagtattggttctttgatcgtattgtatagttt
gaatccacattcgcaaaggtatgatttgtatagtatggtcacgggtcttttcctaacagg
attaggaatctacttcttcatgaaggggaaaaaaagagaagaagcaaaggagaaaaataa
c


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005351       F:sugar:hydrogen symporter activity
GO:0008982       F:protein-N(PI)-phosphohistidine-sugar phosph...
GO:0009401       P:phosphoenolpyruvate-dependent sugar phospho...
GO:0016021       C:integral to membrane
fig|525279.3.peg.2376 Enterococcus faecium TX1330 FIG   PTS system, cellobiose-specific IIC component (EC 2.7.1.69)
fig|529885.3.peg.2163 Enterococcus faecium E980 FIG   PTS system, cellobiose-specific IIC component (EC 2.7.1.69)
fig|565659.3.peg.2009 Enterococcus faecium 1,141,733 FIG   PTS system, cellobiose-specific IIC component (EC 2.7.1.69)
fig|565662.4.peg.2030 Enterococcus faecium Com12 FIG   PTS system, cellobiose-specific IIC component (EC 2.7.1.69)
fig|702448.3.peg.351 Enterococcus faecalis PC1.1 FIG   PTS system, cellobiose-specific IIC component (EC 2.7.1.69)
gb|EEI61351.1 Enterococcus faecium TX1330     PTS family lactose/cellobiose porter component IIC
gb|EEV51491.1 Enterococcus faecium 1,141,733     PTS lactose/cellobiose IIC component
gb|EEV60106.1 Enterococcus faecium Com12     PTS lactose/cellobiose IIC component
gb|EEV62104.1 Enterococcus faecium Com15     PTS lactose/cellobiose IIC component
gi|227180379 Enterococcus faecium TX1330 NCBI   PTS family lactose/cellobiose porter component IIC
gi|227550478 Enterococcus faecium TX1330 NCBI   PTS family lactose/cellobiose porter component IIC
gi|257824559 Enterococcus faecium 1,141,733 NCBI   PTS lactose/cellobiose IIC component
gi|257833685 Enterococcus faecium Com12 NCBI   PTS lactose/cellobiose IIC component
gi|257837030 Enterococcus faecium Com15 NCBI   PTS lactose/cellobiose IIC component
gi|257888505 Enterococcus faecium 1,141,733 NCBI   PTS lactose/cellobiose IIC component
gi|257897120 Enterococcus faecium Com12 NCBI   PTS lactose/cellobiose IIC component
gi|257899118 Enterococcus faecium Com15 NCBI   PTS lactose/cellobiose IIC component
ref|ZP_03980527.1 Enterococcus faecium TX1330 RefSeq   PTS family lactose/cellobiose porter component IIC
ref|ZP_05668158.1 Enterococcus faecium 1,141,733 RefSeq   PTS lactose/cellobiose IIC component
ref|ZP_05676773.1 Enterococcus faecium Com12 RefSeq   PTS lactose/cellobiose IIC component
ref|ZP_05678771.1 Enterococcus faecium Com15 RefSeq   PTS lactose/cellobiose IIC component
tr|C2H888 Enterococcus faecium TX1330 TrEMBL   PTS family lactose/cellobiose porter component IIC


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|565663.4.peg.1426 DNA-directed RNA polymerase specialized sigma subunit, sigma24-like
11 fig|565663.4.peg.1430 PTS system, cellobiose-specific IIA component (EC 2.7.1.69)
12 fig|565663.4.peg.1431 PTS system, cellobiose-specific IIB component (EC 2.7.1.69)
4 fig|565663.4.peg.1433 ATP-dependent RNA helicase YfmL


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search