The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
 The SEED


FIG search

Protein fig|565663.4.peg.1427: Enterococcus faecium Com15

This feature in The SEED Viewer

NCBI Taxonomy Id: 565663

Current Assignment: FIG00629913: hypothetical protein
Translate Function Assignments


Context on contig NZ_GG670326 from base 167577 to 178107 (10531 bp)

Fid Start End Size
(nt)		   Gap Find
best
clusters		 Pins Fc-sc SS Ev Function Aliases
1421 167577 168230 654 +           hypothetical protein  
1422 168367 169017 651 + 136         Hypothetical secreted protein  
1423 169127 170266 1140 + 109         Phage integrase  
rna.26 170408 170335 74 - 68         tRNA-Arg-CCT  
1424 170562 170726 165 + 153         FIG00627422: hypothetical protein  
1425 171979 170798 1182 - 71         conserved hypothetical protein  
1426 172516 172103 414 - 123         DNA-directed RNA polymerase specialized sigma subunit, sigma24-like  
1427 172698 172516 183 - -1         FIG00629913: hypothetical protein  
1428 172951 172730 222 - 31         FIG00628773: hypothetical protein  
1429 174479 173019 1461 - 67         PTS system, cellobiose-specific IIC component (EC 2.7.1.69)  
1430 174907 174587 321 - 107         PTS system, cellobiose-specific IIA component (EC 2.7.1.69)  
1431 175253 174936 318 - 28         PTS system, cellobiose-specific IIB component (EC 2.7.1.69)  
1432 178107 175405 2703 - 151         NtrC family Transcriptional regulator, ATPase domain  

Annotation History   /   View All Related Annotations Help on Annotations


  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|565663.4.peg.1427 FIG00629913: hypothetical protein
MIKNGLFLCSIGSLIVLYSLNPHSQRYDLYSMVTGLFLTGLGIYFFMKGKKREEAKEKNN

MD5 = 42923a18b742c7e3f8c7d3a8eac76011


  DNA Sequence

>fig|565663.4.peg.1427 FIG00629913: hypothetical protein
atgataaaaaacggtttatttttatgtagtattggttctttgatcgtattgtatagtttg
aatccacattcgcaaaggtatgatttgtatagtatggtcacgggtcttttcctaacagga
ttaggaatctacttcttcatgaaggggaaaaaaagagaagaagcaaaggagaaaaataac
taa


  DNA with Flanking Sequence

>fig|565663.4.peg.1427 FIG00629913: hypothetical protein
ccagtttcgcaacaagttacatgggtagtaccgccgttcttattgtcattcttagcaaca
ggagcggattggcgagcaccaatcgtaacgttggtatgtatggtcgtgactttcttgatt
tgggcaccgtttgtcatttctgcaaacaaaatggaccctgccgcaggcgaacaacaataa
gatgaatctgaggagcgggacgctttaagtttcgttcctcataatgaattttcgaggagg
aactgaaatgatttcaattgccagtgcaatgcaacaagatgcaatcaaagaattgttaga
aggatacaatgaagaaggaatgacatttacgtttaaagaaaaacaaggaatcaaaatgtt
ctttgaaacaagtgcagaagatccggaagctgcggctaaaaaagcaaaggaactaatcaa
agcacagccttggggaacagtcctttattttcagtcaacagctgtttaagaaaatggttc
aaaaagataggatggttgatatgataaaaaacggtttatttttatgtagtattggttctt
tgatcgtattgtatagtttgaatccacattcgcaaaggtatgatttgtatagtatggtca
cgggtcttttcctaacaggattaggaatctacttcttcatgaaggggaaaaaaagagaag
aagcaaaggagaaaaataactaatggaaatcacaaaaaaattaaatattccagcgtcgtt
tttttacgataaagttatggattctgttcttttcgatgtacgtaaagcgaccggcaaatc
agtgaccagaaaacagctgaaaaatttggagtacgtcaaacaattctcgcaaaataaccg
ggctcgtataaaaatcgaagaagtcattgaaaaccagtcttataagtttcgtacatcgac
aacgaagaatgaattcgttgttcattatcaaatcaaaccagtagacgattcgacctgtga
ggttcattacacagaaaaaatggagtcttatggcatgcttcaaaagttgaatgatatgct
tttaggaacaatcttgatgtactttaagcggagacgtttcaaaaaaatgctagagatgat
cgaagcaacgtattaaaccagtgaaaaaatggtactatttagttattgaaaaatgaagta
agctagaagagatttttcagagggagcgaggtctttcctgaga


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|333849.6.peg.4310 Enterococcus faecium DO FIG   FIG00629913: hypothetical protein
fig|333849.6.peg.504 Enterococcus faecium DO FIG   FIG00629913: hypothetical protein
fig|525279.3.peg.2378 Enterococcus faecium TX1330 FIG   FIG00629913: hypothetical protein
fig|529885.3.peg.2161 Enterococcus faecium E980 FIG   FIG00629913: hypothetical protein
fig|535206.4.peg.1054 Enterococcus faecium E1162 FIG   FIG00629913: hypothetical protein
fig|544875.4.peg.744 Enterococcus faecium E1636 FIG   FIG00629913: hypothetical protein
fig|546340.3.peg.1642 Enterococcus faecium E1679 FIG   FIG00629913: hypothetical protein
fig|547468.4.peg.957 Enterococcus faecium U0317 FIG   FIG00629913: hypothetical protein
fig|565656.3.peg.1294 Enterococcus faecium 1,230,933 FIG   FIG00629913: hypothetical protein
fig|565657.5.peg.884 Enterococcus faecium 1,231,502 FIG   FIG00629913: hypothetical protein
fig|565658.4.peg.1462 Enterococcus faecium 1,231,501 FIG   FIG00629913: hypothetical protein
fig|565659.3.peg.2011 Enterococcus faecium 1,141,733 FIG   FIG00629913: hypothetical protein
fig|565660.4.peg.774 Enterococcus faecium 1,231,410 FIG   FIG00629913: hypothetical protein
fig|565661.4.peg.1487 Enterococcus faecium 1,231,408 FIG   FIG00629913: hypothetical protein
fig|565662.4.peg.2028 Enterococcus faecium Com12 FIG   FIG00629913: hypothetical protein
fig|565664.3.peg.629 Enterococcus faecium C68 FIG   FIG00629913: hypothetical protein
fig|565665.3.peg.516 Enterococcus faecium D344SRF FIG   FIG00629913: hypothetical protein
fig|565666.3.peg.49 Enterococcus faecium TC 6 FIG   FIG00629913: hypothetical protein
fig|645663.4.peg.564 Enterococcus faecium E1039 FIG   FIG00629913: hypothetical protein
fig|702448.3.peg.349 Enterococcus faecalis PC1.1 FIG   FIG00629913: hypothetical protein
gb|EAN10713.1 Enterococcus faecium DO     conserved hypothetical protein
gb|EEV42374.1 Enterococcus faecium 1,230,933     conserved hypothetical protein
gb|EEV44732.1 Enterococcus faecium 1,231,502     conserved hypothetical protein
gb|EEV48186.1 Enterococcus faecium 1,231,501     conserved hypothetical protein
gb|EEV51493.1 Enterococcus faecium 1,141,733     conserved hypothetical protein
gb|EEV53200.1 Enterococcus faecium 1,231,410     conserved hypothetical protein
gb|EEV56528.1 Enterococcus faecium 1,231,408     conserved hypothetical protein
gb|EEV60104.1 Enterococcus faecium Com12     conserved hypothetical protein
gb|EEV62102.1 Enterococcus faecium Com15     conserved hypothetical protein
gi|257813616 Enterococcus faecium 1,230,933 NCBI   conserved hypothetical protein
gi|257817404 Enterococcus faecium 1,231,502 NCBI   conserved hypothetical protein
gi|257821052 Enterococcus faecium 1,231,501 NCBI   conserved hypothetical protein
gi|257824561 Enterococcus faecium 1,141,733 NCBI   conserved hypothetical protein
gi|257826574 Enterococcus faecium 1,231,410 NCBI   conserved hypothetical protein
gi|257829921 Enterococcus faecium 1,231,408 NCBI   conserved hypothetical protein
gi|257833683 Enterococcus faecium Com12 NCBI   conserved hypothetical protein
gi|257837028 Enterococcus faecium Com15 NCBI   conserved hypothetical protein
gi|257879388 Enterococcus faecium 1,230,933 NCBI   conserved hypothetical protein
gi|257881746 Enterococcus faecium 1,231,502 NCBI   conserved hypothetical protein
gi|257885200 Enterococcus faecium 1,231,501 NCBI   conserved hypothetical protein
gi|257888507 Enterococcus faecium 1,141,733 NCBI   conserved hypothetical protein
gi|257890214 Enterococcus faecium 1,231,410 NCBI   conserved hypothetical protein
gi|257893542 Enterococcus faecium 1,231,408 NCBI   conserved hypothetical protein
gi|257897118 Enterococcus faecium Com12 NCBI   conserved hypothetical protein
gi|257899116 Enterococcus faecium Com15 NCBI   conserved hypothetical protein
gi|258615798 Enterococcus faecium DO NCBI   hypothetical protein EfaeD_08809
gi|68196284 Enterococcus faecium DO NCBI   conserved hypothetical protein
gi|69244693 Enterococcus faecium DO NCBI   conserved hypothetical protein
img|638350833 Enterococcus faecium DO IMG   conserved hypothetical protein
ref|ZP_00602957.1 Enterococcus faecium DO RefSeq   conserved hypothetical protein
ref|ZP_05659041.1 Enterococcus faecium 1,230,933 RefSeq   conserved hypothetical protein
ref|ZP_05661399.1 Enterococcus faecium 1,231,502 RefSeq   conserved hypothetical protein
ref|ZP_05664853.1 Enterococcus faecium 1,231,501 RefSeq   conserved hypothetical protein
ref|ZP_05668160.1 Enterococcus faecium 1,141,733 RefSeq   conserved hypothetical protein
ref|ZP_05669867.1 Enterococcus faecium 1,231,410 RefSeq   conserved hypothetical protein
ref|ZP_05673195.1 Enterococcus faecium 1,231,408 RefSeq   conserved hypothetical protein
ref|ZP_05676771.1 Enterococcus faecium Com12 RefSeq   conserved hypothetical protein
ref|ZP_05678769.1 Enterococcus faecium Com15 RefSeq   conserved hypothetical protein
ref|ZP_05713568.1 Enterococcus faecium DO RefSeq   hypothetical protein EfaeD_08809
tr|Q3Y2J9 Enterococcus faecium DO TrEMBL   Putative uncharacterized protein precursor


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link

  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key		 Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer

Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options

|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions
FIG search