The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|565663.4.peg.1424: Enterococcus faecium Com15

This feature in The SEED Viewer

NCBI Taxonomy Id: 565663

Current Assignment: FIG00627422: hypothetical protein
Turn Off Function Translation



Context on contig NZ_GG670326 from base 166061 to 178107 (12047 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1418 166219 166061 159 -           hypothetical protein  
1419 166416 166231 186 - 11         cro  
1420 166720 167094 375 + 303         Phage transcriptional regulator, Cro/CI family  
1421 167577 168230 654 + 482         hypothetical protein  
1422 168367 169017 651 + 136         Hypothetical secreted protein  
1423 169127 170266 1140 + 109         Phage integrase  
rna.26 170408 170335 74 - 68         tRNA-Arg-CCT  
1424 170562 170726 165 + 153         FIG00627422: hypothetical protein  
1425 171979 170798 1182 - 71         conserved hypothetical protein  
1426 172516 172103 414 - 123         DNA-directed RNA polymerase specialized sigma subunit, sigma24-like  
1427 172698 172516 183 - -1         FIG00629913: hypothetical protein  
1428 172951 172730 222 - 31         FIG00628773: hypothetical protein  
1429 174479 173019 1461 - 67         PTS system, cellobiose-specific IIC component (EC 2.7.1.69)  
1430 174907 174587 321 - 107         PTS system, cellobiose-specific IIA component (EC 2.7.1.69)  
1431 175253 174936 318 - 28         PTS system, cellobiose-specific IIB component (EC 2.7.1.69)  
1432 178107 175405 2703 - 151         NtrC family Transcriptional regulator, ATPase domain  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|565663.4.peg.1424 FIG00627422: hypothetical protein
MNDKPKEKVYAERLDSSKKNREKITKEAIQDHKKENPKTKENKKFKFTKKEDLL

MD5 = 4cb1e8325c850dfa054249316529bf60


  DNA Sequence

>fig|565663.4.peg.1424 FIG00627422: hypothetical protein
atgaatgataagccaaaagaaaaagtatatgccgaacgcttagattcatctaaaaaaaat
cgggaaaagattacgaaagaagcaatccaagaccacaaaaaagaaaaccctaaaacaaaa
gaaaacaaaaaattcaaatttacgaaaaaagaggatttactttaa


  DNA with Flanking Sequence

>fig|565663.4.peg.1424 FIG00627422: hypothetical protein
atttactttgcatgggctaaggcatacacatgcatctattttactttatcaaggagtaaa
tatacttagcgtatcgaaacgtttaggacatagcagtttagaaaccacaatgtctactta
ccttcatattgttcgagagcttgaagatcaggataaagaaaaaatcaatgctgtgttcga
tagtttatataaaaatgataactagtttggcacatttttggcacaaatataaaacaaacc
ccagtatcacaaaggatacaggggttatttgtacgttcctgactggaattgaaccagcga
cctatcgcttaggaggcgattgctctatcctactgagctacaggaacaatttcaataaat
caattgtagcttgtttgttttttacttgcaagcttatctgctaaaaaaatcagcttgtaa
gttaggcaaatcgtttccactagctcttaacagatgataaactaggagtagaatgaaata
atacagggaggttctttccaatgaatgataagccaaaagaaaaagtatatgccgaacgct
tagattcatctaaaaaaaatcgggaaaagattacgaaagaagcaatccaagaccacaaaa
aagaaaaccctaaaacaaaagaaaacaaaaaattcaaatttacgaaaaaagaggatttac
tttaacattttccttcaaatgccaaacgaaaaaacaaaagggtggtgacaaaaatattgt
catcaccctttttttatcaaaaatagtcattaaggattggctgttgctgtggcaagatcg
agcttaacgtttcttcatattcttttgccacctgtatcctctcttggaataccagctctt
caactttacgatatcctaataatagctgtgtgatatgttggatacttccgcgaacgatcg
gtaatgctgtttgttctacttttgagagatggttttttccatttttgatcgttacttcca
cgattccttcattccattttgcatactgatcttcttctatctgaagggcaaaggcagctt
gtttctttctaaatggatatttttccaaaaacaaagaaatatctacgatcctcgccatca
tataaggtgtgatcgttacagaagcaaatggatttgctaatagataattttgatcattgc
caccgtagccacatgaatattcaaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|333849.6.peg.4313 Enterococcus faecium DO FIG   FIG00627422: hypothetical protein
fig|333849.6.peg.501 Enterococcus faecium DO FIG   FIG00627422: hypothetical protein
fig|525279.3.peg.2381 Enterococcus faecium TX1330 FIG   FIG00627422: hypothetical protein
fig|529885.3.peg.2158 Enterococcus faecium E980 FIG   FIG00627422: hypothetical protein
fig|535205.4.peg.975 Enterococcus faecium E1071 FIG   FIG00627422: hypothetical protein
fig|535206.4.peg.1051 Enterococcus faecium E1162 FIG   FIG00627422: hypothetical protein
fig|544875.4.peg.741 Enterococcus faecium E1636 FIG   FIG00627422: hypothetical protein
fig|546340.3.peg.1645 Enterococcus faecium E1679 FIG   FIG00627422: hypothetical protein
fig|547468.4.peg.960 Enterococcus faecium U0317 FIG   FIG00627422: hypothetical protein
fig|565656.3.peg.1297 Enterococcus faecium 1,230,933 FIG   FIG00627422: hypothetical protein
fig|565657.5.peg.881 Enterococcus faecium 1,231,502 FIG   FIG00627422: hypothetical protein
fig|565658.4.peg.1465 Enterococcus faecium 1,231,501 FIG   FIG00627422: hypothetical protein
fig|565659.3.peg.2014 Enterococcus faecium 1,141,733 FIG   FIG00627422: hypothetical protein
fig|565662.4.peg.2025 Enterococcus faecium Com12 FIG   FIG00627422: hypothetical protein
fig|565664.3.peg.632 Enterococcus faecium C68 FIG   FIG00627422: hypothetical protein
fig|565665.3.peg.519 Enterococcus faecium D344SRF FIG   FIG00627422: hypothetical protein
fig|565666.3.peg.52 Enterococcus faecium TC 6 FIG   FIG00627422: hypothetical protein
fig|645663.4.peg.567 Enterococcus faecium E1039 FIG   FIG00627422: hypothetical protein
gb|EAN10757.1 Enterococcus faecium DO     hypothetical protein EfaeDRAFT_2245
gb|EEI61356.1 Enterococcus faecium TX1330     conserved hypothetical protein
gb|EEV42377.1 Enterococcus faecium 1,230,933     predicted protein
gb|EEV44729.1 Enterococcus faecium 1,231,502     predicted protein
gb|EEV48189.1 Enterococcus faecium 1,231,501     predicted protein
gb|EEV51496.1 Enterococcus faecium 1,141,733     predicted protein
gb|EEV60101.1 Enterococcus faecium Com12     predicted protein
gb|EEV62099.1 Enterococcus faecium Com15     predicted protein
gi|227180384 Enterococcus faecium TX1330 NCBI   conserved hypothetical protein
gi|227550483 Enterococcus faecium TX1330 NCBI   conserved hypothetical protein
gi|257813619 Enterococcus faecium 1,230,933 NCBI   predicted protein
gi|257817401 Enterococcus faecium 1,231,502 NCBI   predicted protein
gi|257821055 Enterococcus faecium 1,231,501 NCBI   predicted protein
gi|257824564 Enterococcus faecium 1,141,733 NCBI   predicted protein
gi|257833680 Enterococcus faecium Com12 NCBI   predicted protein
gi|257837025 Enterococcus faecium Com15 NCBI   predicted protein
gi|257879391 Enterococcus faecium 1,230,933 NCBI   predicted protein
gi|257881743 Enterococcus faecium 1,231,502 NCBI   predicted protein
gi|257885203 Enterococcus faecium 1,231,501 NCBI   predicted protein
gi|257888510 Enterococcus faecium 1,141,733 NCBI   predicted protein
gi|257897115 Enterococcus faecium Com12 NCBI   predicted protein
gi|257899113 Enterococcus faecium Com15 NCBI   predicted protein
gi|258615801 Enterococcus faecium DO NCBI   hypothetical protein EfaeD_08824
gi|68196328 Enterococcus faecium DO NCBI   hypothetical protein EfaeDRAFT_2245
gi|69244737 Enterococcus faecium DO NCBI   hypothetical protein EfaeDRAFT_2245
img|638350830 Enterococcus faecium DO IMG   hypothetical protein
ref|ZP_00603001.1 Enterococcus faecium DO RefSeq   hypothetical protein EfaeDRAFT_2245
ref|ZP_03980532.1 Enterococcus faecium TX1330 RefSeq   conserved hypothetical protein
ref|ZP_05659044.1 Enterococcus faecium 1,230,933 RefSeq   predicted protein
ref|ZP_05661396.1 Enterococcus faecium 1,231,502 RefSeq   predicted protein
ref|ZP_05664856.1 Enterococcus faecium 1,231,501 RefSeq   predicted protein
ref|ZP_05668163.1 Enterococcus faecium 1,141,733 RefSeq   predicted protein
ref|ZP_05676768.1 Enterococcus faecium Com12 RefSeq   predicted protein
ref|ZP_05678766.1 Enterococcus faecium Com15 RefSeq   predicted protein
ref|ZP_05713571.1 Enterococcus faecium DO RefSeq   hypothetical protein EfaeD_08824
tr|C2H893 Enterococcus faecium TX1330 TrEMBL   Putative uncharacterized protein
tr|Q3Y2K2 Enterococcus faecium DO TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search