The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|565663.4.peg.1423: Enterococcus faecium Com15

This feature in The SEED Viewer

NCBI Taxonomy Id: 565663

Current Assignment: Phage integrase
Translate Function Assignments



Context on contig NZ_GG670326 from base 164057 to 175253 (11197 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1416 164839 164057 783 -           Phage antirepressor protein  
1417 164900 165520 621 + 60         hypothetical protein  
1418 166219 166061 159 - 540         hypothetical protein  
1419 166416 166231 186 - 11         cro  
1420 166720 167094 375 + 303         Phage transcriptional regulator, Cro/CI family  
1421 167577 168230 654 + 482         hypothetical protein  
1422 168367 169017 651 + 136         Hypothetical secreted protein  
1423 169127 170266 1140 + 109         Phage integrase  
rna.26 170408 170335 74 - 68         tRNA-Arg-CCT  
1424 170562 170726 165 + 153         FIG00627422: hypothetical protein  
1425 171979 170798 1182 - 71         conserved hypothetical protein  
1426 172516 172103 414 - 123         DNA-directed RNA polymerase specialized sigma subunit, sigma24-like  
1427 172698 172516 183 - -1         FIG00629913: hypothetical protein  
1428 172951 172730 222 - 31         FIG00628773: hypothetical protein  
1429 174479 173019 1461 - 67         PTS system, cellobiose-specific IIC component (EC 2.7.1.69)  
1430 174907 174587 321 - 107         PTS system, cellobiose-specific IIA component (EC 2.7.1.69)  
1431 175253 174936 318 - 28         PTS system, cellobiose-specific IIB component (EC 2.7.1.69)  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|565663.4.peg.1423 Phage integrase
MARLVKRGNSWQYEISYKKDDGKYTKIRKSGFKTKGEAKDAANELEYNLNKGLKGDRKNL
LLSDYFEDWMQLYKEGTVSPITYRKYEDTLMNIKKYMPAVLISDLDRVGYQRFLNKYAKD
HVKSTVIKFNNHIRASLKDAVEEGLIPFDPTRKAVIKGKDSLKPKEDKYLDYDQFKSLMK
LVEENLSAQYSSPMLVLVAGATGMRFAELLGLTWEDIDFEDQIITINKTWNYKLNEWGKT
KNETSNRKISIDKHTIDLLKKFKINQKELFDNFEVKNPHNFVFFNLKNGLVSSNAVSKYL
RKKLKELGIEKQFTLHGLRHTHASILLYQGVNILSVSKRLGHSSLETTMSTYLHIVRELE
DQDKEKINAVFDSLYKNDN

MD5 = 771621cc34d5cf1e496764549eefe985


  DNA Sequence

>fig|565663.4.peg.1423 Phage integrase
atggcaagattagtcaaacgtggaaatagttggcaatacgaaatttcatacaaaaaagat
gacggaaaatacacgaagataagaaaatcaggattcaagacaaaaggcgaagcaaaagat
gccgccaacgaattagaatataacctgaataaaggtcttaaaggggatcgcaaaaatcta
ttattatcagattactttgaagattggatgcaactctacaaagaaggaacagtatctcct
atcacttatagaaaatacgaagatacgttaatgaatataaagaaatatatgccagcagta
ttgatttctgatttagatagagttggatatcaacgctttttaaataagtatgcgaaagac
catgtaaaatccaccgttattaagtttaataaccatattagagcatcgttgaaagatgcc
gtagaagaaggattaattccgtttgatccaactagaaaagcagtaatcaaaggaaaagat
tcattgaagccaaaagaagataaatatttagattatgatcaatttaaatctttaatgaaa
ctcgtagaagaaaacctttctgcacagtactcttctcctatgctcgtgttagttgctggt
gctactggaatgcgatttgctgaacttctaggattaacatgggaagatatcgatttcgaa
gatcaaatcatcactattaataaaacatggaattataaattaaatgaatggggaaaaaca
aaaaacgagacttcaaatcggaaaatttcaattgataaacatacgattgatctcttaaaa
aagtttaaaatcaatcaaaaagaattattcgataattttgaagttaaaaaccctcataat
tttgtttttttcaacttaaaaaatggattagtttcatcaaacgccgtcagcaaatatttg
cgcaaaaaattaaaagaattagggattgaaaagcaatttactttgcatgggctaaggcat
acacatgcatctattttactttatcaaggagtaaatatacttagcgtatcgaaacgttta
ggacatagcagtttagaaaccacaatgtctacttaccttcatattgttcgagagcttgaa
gatcaggataaagaaaaaatcaatgctgtgttcgatagtttatataaaaatgataactag


  DNA with Flanking Sequence

>fig|565663.4.peg.1423 Phage integrase
aactgaacaggtaacaaatgacgaagataattttacaaatgccgaatataactttagtgg
aatagaaaattttccagaaaaatactatcgtactactatttcttacaagttaaaaaataa
agcaacatcacctttctctttgtcttcgtatcaggcatctttaatagatggagacggtat
ggaatatagtagaacagctggagaatatttcttatatgacgaaaattctaattctttagt
tcaacctgaaacgacaacatctggggttttctatttactttctaaaaataaaccaaattt
aagtacatttaaacttaatgcgtctaaacaatttactgatgattttacagctgagccgat
tggcgaagcaggaacaacagagtataaataaaaaacacgccccctccctcgccaaagttt
gtggacgcgttaaaaacaaacctacacaataggcttctttacagtgcctattgtatcaga
gaaagagagtagattcaattatggcaagattagtcaaacgtggaaatagttggcaatacg
aaatttcatacaaaaaagatgacggaaaatacacgaagataagaaaatcaggattcaaga
caaaaggcgaagcaaaagatgccgccaacgaattagaatataacctgaataaaggtctta
aaggggatcgcaaaaatctattattatcagattactttgaagattggatgcaactctaca
aagaaggaacagtatctcctatcacttatagaaaatacgaagatacgttaatgaatataa
agaaatatatgccagcagtattgatttctgatttagatagagttggatatcaacgctttt
taaataagtatgcgaaagaccatgtaaaatccaccgttattaagtttaataaccatatta
gagcatcgttgaaagatgccgtagaagaaggattaattccgtttgatccaactagaaaag
cagtaatcaaaggaaaagattcattgaagccaaaagaagataaatatttagattatgatc
aatttaaatctttaatgaaactcgtagaagaaaacctttctgcacagtactcttctccta
tgctcgtgttagttgctggtgctactggaatgcgatttgctgaacttctaggattaacat
gggaagatatcgatttcgaagatcaaatcatcactattaataaaacatggaattataaat
taaatgaatggggaaaaacaaaaaacgagacttcaaatcggaaaatttcaattgataaac
atacgattgatctcttaaaaaagtttaaaatcaatcaaaaagaattattcgataattttg
aagttaaaaaccctcataattttgtttttttcaacttaaaaaatggattagtttcatcaa
acgccgtcagcaaatatttgcgcaaaaaattaaaagaattagggattgaaaagcaattta
ctttgcatgggctaaggcatacacatgcatctattttactttatcaaggagtaaatatac
ttagcgtatcgaaacgtttaggacatagcagtttagaaaccacaatgtctacttaccttc
atattgttcgagagcttgaagatcaggataaagaaaaaatcaatgctgtgttcgatagtt
tatataaaaatgataactagtttggcacatttttggcacaaatataaaacaaaccccagt
atcacaaaggatacaggggttatttgtacgttcctgactggaattgaaccagcgacctat
cgcttaggaggcgattgctctatcctactgagctacaggaacaatttcaataaatcaatt
gtagcttgtttgttttttacttgcaagcttatctgctaaaaaaatcagcttgtaagttag
gcaaatcgtttccactagctcttaacagatgataaactaggagtagaatgaaataataca
gggaggttctttccaatgaatgataagccaaaagaaaaagtatatgccgaacgcttagat
tcatctaaaaaaaatcgggaaaagattacgaaagaagcaatccaagaccacaaaaaagaa
aaccctaaaacaaaagaaaacaaaaaattcaaatttacgaaaaaagaggatttactttaa
cattttccttcaaatgccaaacgaaaaaacaaaagggtgg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
gb|EEV62098.1 Enterococcus faecium Com15     phage integrase
gi|257837024 Enterococcus faecium Com15 NCBI   phage integrase
gi|257899112 Enterococcus faecium Com15 NCBI   phage integrase
ref|ZP_05678765.1 Enterococcus faecium Com15 RefSeq   phage integrase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search