The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|565663.4.peg.1420: Enterococcus faecium Com15

This feature in The SEED Viewer

NCBI Taxonomy Id: 565663

Current Assignment: Phage transcriptional regulator, Cro/CI family
Translate Function Assignments



Context on contig NZ_GG670326 from base 161812 to 171979 (10168 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1411 162510 161812 699 -   7     Uncharacterized phage-encoded protein-like  
1412 162565 163230 666 + 54         hypothetical protein  
1413 163498 163328 171 - 97         FIG00631288: hypothetical protein  
1414 163823 163485 339 - -14         FIG00628305: hypothetical protein  
1415 164042 163839 204 - 15         hypothetical protein  
1416 164839 164057 783 - 14 4     Phage antirepressor protein  
1417 164900 165520 621 + 60         hypothetical protein  
1418 166219 166061 159 - 540         hypothetical protein  
1419 166416 166231 186 - 11         cro  
1420 166720 167094 375 + 303       Phage transcriptional regulator, Cro/CI family  
1421 167577 168230 654 + 482         hypothetical protein  
1422 168367 169017 651 + 136         Hypothetical secreted protein  
1423 169127 170266 1140 + 109 4     Phage integrase  
rna.26 170408 170335 74 - 68         tRNA-Arg-CCT  
1424 170562 170726 165 + 153         FIG00627422: hypothetical protein  
1425 171979 170798 1182 - 71         conserved hypothetical protein  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|565663.4.peg.1420 Phage transcriptional regulator, Cro/CI family
MSLVTKIKELADEKHVTIAEVERQVGISNGQIRRWDKASPKSENLKKVADYFGVTTDYLL
GNNNVPKWATKEEVVELDKLLDSNVNMSYGGETLTPEQIQRVKDILIATFWDIVKEDKEK
GKKM

MD5 = 7ccdba1f0a77ee67ddb480f3b6586e36


  DNA Sequence

>fig|565663.4.peg.1420 Phage transcriptional regulator, Cro/CI family
atgagtttagttactaagattaaagaattagcagacgaaaagcatgtgactatagcagaa
gtagaaagacaggtgggcatctctaatggacaaataagaagatgggataaagcctcgcca
aaatctgagaacttaaagaaagttgctgattattttggtgtcacaactgattatttattg
ggaaataataatgttcccaaatgggctacaaaagaggaagtggttgaacttgataaacta
ctagactcaaatgttaatatgtcttatggtggggaaacattgacacccgaacaaatacag
cgcgtaaaagatatcctgatagcgactttctgggatattgtgaaagaagacaaagaaaaa
ggcaaaaagatgtga


  DNA with Flanking Sequence

>fig|565663.4.peg.1420 Phage transcriptional regulator, Cro/CI family
ctatttctctcctatcggatatccaatatttttttcactgtttcgatatgctgttgtgct
ttctttccatcacgattgccgtttagaatatctgataaataagctcctgaaataccgata
agcgcagctagttctttgaaagtcattcttctttttctcatctccgctcgaatttttaag
tctaaattctcagacataaaaatagctcctttctaaacaaataatttgtaagctaaaaaa
ttagctaaatcgttgacacctattagcttttaagctattatgaatacatagttaaataag
acttataaaaagtctctaaaataacatttctaagtttggcgaccgagagaatgttttaaa
ttagtagagttttttgttgctcttatttagctaacaatttagcttacgaattaaatatac
tagcttaaaagctaattgtcaaccaaaaatttaacttttaagctatttattttcttttca
gctttgaaaggttgataataatgagtttagttactaagattaaagaattagcagacgaaa
agcatgtgactatagcagaagtagaaagacaggtgggcatctctaatggacaaataagaa
gatgggataaagcctcgccaaaatctgagaacttaaagaaagttgctgattattttggtg
tcacaactgattatttattgggaaataataatgttcccaaatgggctacaaaagaggaag
tggttgaacttgataaactactagactcaaatgttaatatgtcttatggtggggaaacat
tgacacccgaacaaatacagcgcgtaaaagatatcctgatagcgactttctgggatattg
tgaaagaagacaaagaaaaaggcaaaaagatgtgagcttatggagatggatacgattaat
ttagtcgaggagttgaagcggaaataccagtccgctaatcctttttatatttgtgaaaag
atgggcattaaaattcaatacgttccttttatcgagaatcccaaggggcagtttcaagaa
attagagatcgtgcgataatctttttaaatgatgaactgcgagactctgaggaaagattc
tacatttgcgctcacgaattaggccacgctatttttcatcgtggcttatccagctattat
gtatcaacaagaacatctagaagcaaatctgaaagcgaagctaattgctttgctgctaat
ctcattgtttctctttataaagaagataatgatcaatatcctaaaaaaatcgaggaatta
aagaatctttacgggcttccagaaagcgcttatcgttttcttatataaaaaagcccatgt
tagcacacatattacaacgagaaagaggaattataaaatgaaaaaagttagcgtt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|565665.3.peg.2009 Enterococcus faecium D344SRF FIG   Phage transcriptional regulator, Cro/CI family
fig|565666.3.peg.1484 Enterococcus faecium TC 6 FIG   Phage transcriptional regulator, Cro/CI family
gb|EEV62094.1 Enterococcus faecium Com15     transcriptional regulator
gi|257837020 Enterococcus faecium Com15 NCBI   transcriptional regulator
gi|257899108 Enterococcus faecium Com15 NCBI   transcriptional regulator
ref|ZP_05678761.1 Enterococcus faecium Com15 RefSeq   transcriptional regulator


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
7 fig|565663.4.peg.1411 Uncharacterized phage-encoded protein-like
4 fig|565663.4.peg.1416 Phage antirepressor protein
4 fig|565663.4.peg.1423 Phage integrase


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search