The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|565663.4.peg.1419: Enterococcus faecium Com15

This feature in The SEED Viewer

NCBI Taxonomy Id: 565663

Current Assignment: cro
Translate Function Assignments



Context on contig NZ_GG670326 from base 160566 to 171979 (11414 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1409 161300 160566 735 -           Phage protein  
1410 161634 161293 342 - -8         FIG00627384: hypothetical protein  
1411 162510 161812 699 - 177         Uncharacterized phage-encoded protein-like  
1412 162565 163230 666 + 54         hypothetical protein  
1413 163498 163328 171 - 97         FIG00631288: hypothetical protein  
1414 163823 163485 339 - -14         FIG00628305: hypothetical protein  
1415 164042 163839 204 - 15         hypothetical protein  
1416 164839 164057 783 - 14         Phage antirepressor protein  
1417 164900 165520 621 + 60         hypothetical protein  
1418 166219 166061 159 - 540         hypothetical protein  
1419 166416 166231 186 - 11         cro  
1420 166720 167094 375 + 303         Phage transcriptional regulator, Cro/CI family  
1421 167577 168230 654 + 482         hypothetical protein  
1422 168367 169017 651 + 136         Hypothetical secreted protein  
1423 169127 170266 1140 + 109         Phage integrase  
rna.26 170408 170335 74 - 68         tRNA-Arg-CCT  
1424 170562 170726 165 + 153         FIG00627422: hypothetical protein  
1425 171979 170798 1182 - 71         conserved hypothetical protein  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|565663.4.peg.1419 cro
MSENLDLKIRAEMRKRRMTFKELAALIGISGAYLSDILNGNRDGKKAQQHIETVKKILDI
R

MD5 = 004ee38b7684118cd54934fa65d94fc2


  DNA Sequence

>fig|565663.4.peg.1419 cro
atgtctgagaatttagacttaaaaattcgagcggagatgagaaaaagaagaatgactttc
aaagaactagctgcgcttatcggtatttcaggagcttatttatcagatattctaaacggc
aatcgtgatggaaagaaagcacaacagcatatcgaaacagtgaaaaaaatattggatatc
cgatag


  DNA with Flanking Sequence

>fig|565663.4.peg.1419 cro
ggaacattattatttcccaataaataatcagttgtgacaccaaaataatcagcaactttc
tttaagttctcagattttggcgaggctttatcccatcttcttatttgtccattagagatg
cccacctgtctttctacttctgctatagtcacatgcttttcgtctgctaattctttaatc
ttagtaactaaactcattattatcaacctttcaaagctgaaaagaaaataaatagcttaa
aagttaaatttttggttgacaattagcttttaagctagtatatttaattcgtaagctaaa
ttgttagctaaataagagcaacaaaaaactctactaatttaaaacattctctcggtcgcc
aaacttagaaatgttattttagagactttttataagtcttatttaactatgtattcataa
tagcttaaaagctaataggtgtcaacgatttagctaattttttagcttacaaattatttg
tttagaaaggagctatttttatgtctgagaatttagacttaaaaattcgagcggagatga
gaaaaagaagaatgactttcaaagaactagctgcgcttatcggtatttcaggagcttatt
tatcagatattctaaacggcaatcgtgatggaaagaaagcacaacagcatatcgaaacag
tgaaaaaaatattggatatccgataggagagaaatagatggaaaataaaaaaactgaatt
aataactgtagaaataatcggaattgatgatgcaacaaaaaaagctgaaagatatattga
gttattaaaagaagccaaaacgttggcagacgaattggcttcaaaggaatttgaaattga
gattaagcaggactaaaccttgcctttgaaatcaatttcagctccgcaatatttacactt
gttttttccattagatattttaatttttttaccacaggaaggacaagtataatcgacgcc
cttttttaaaatcttgtttgcttcggattttatgattttttcaaggtcgccactgatttt
aacactggtttttctactcatagatccacctcactttcaatagtgagtataccagagaag
gaggtaacaacatgaaaattagcattgaagcaacgccacaagaaatagcagaattgctcc
aagctattgcgagtagccaggagcaaagaataccatgtgaaaacat


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
gb|EEV62093.1 Enterococcus faecium Com15     predicted protein
gi|257837019 Enterococcus faecium Com15 NCBI   predicted protein
gi|257899107 Enterococcus faecium Com15 NCBI   predicted protein
ref|ZP_05678760.1 Enterococcus faecium Com15 RefSeq   predicted protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search