The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|565663.4.peg.1415: Enterococcus faecium Com15

This feature in The SEED Viewer

NCBI Taxonomy Id: 565663

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NZ_GG670326 from base 158841 to 169017 (10177 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1406 159110 158841 270 -           hypothetical protein  
1407 159871 159122 750 - 11         Phage replication initiation  
1408 160560 159874 687 - 2         Phage protein  
1409 161300 160566 735 - 5         Phage protein  
1410 161634 161293 342 - -8         FIG00627384: hypothetical protein  
1411 162510 161812 699 - 177         Uncharacterized phage-encoded protein-like  
1412 162565 163230 666 + 54         hypothetical protein  
1413 163498 163328 171 - 97         FIG00631288: hypothetical protein  
1414 163823 163485 339 - -14         FIG00628305: hypothetical protein  
1415 164042 163839 204 - 15         hypothetical protein  
1416 164839 164057 783 - 14         Phage antirepressor protein  
1417 164900 165520 621 + 60         hypothetical protein  
1418 166219 166061 159 - 540         hypothetical protein  
1419 166416 166231 186 - 11         cro  
1420 166720 167094 375 + 303         Phage transcriptional regulator, Cro/CI family  
1421 167577 168230 654 + 482         hypothetical protein  
1422 168367 169017 651 + 136         Hypothetical secreted protein  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|565663.4.peg.1415 hypothetical protein
MTDIAEITQRDREKIKEYVESSKFLTYTMLAERFGISKSYLSLILNGKKTSAEANRIIDS
IITMYEL

MD5 = c0961d65c6a25b4612a2c75e52bf0c65


  DNA Sequence

>fig|565663.4.peg.1415 hypothetical protein
atgactgacattgcagaaatcactcaacgagatagagaaaaaatcaaagaatatgtcgaa
agttcaaagttcttaacttacaccatgcttgctgaaagatttggaattagcaaaagctac
ttatctttaattttaaacggtaaaaagacttctgcagaagcaaacagaattatagattcg
attatcactatgtacgaattgtaa


  DNA with Flanking Sequence

>fig|565663.4.peg.1415 hypothetical protein
cttccaacaattagaaaacatggaggttatctaactccagaaaaagtagaagaagctttg
cttaatccagatacaatcattcaattagcaactcaactaaaagaagaaagaactggaaga
ttaatcgcagaacaaaagattgcagagtacgaacctaaaatctcctatttagatagcata
ttatcttctacagattcagtaacaattagtcagattgcagcagattatgggatgtctcca
caacagatgaataaattacttcataaactaggtattcagaaaaaagtcggtaaccaatgg
ttattgtgcaaaaaacacatgaaccaaggatacacaaaatctcatacaactgagatcccg
aaagccgatggtggcactaaaattgtaatgaataccaaatggacacagaaagggcgtcta
tttatctacgaattactaaaaaaagaaggatattaccctcaaatggatttagaggaaatt
ggttagaaaggagttttagtatgactgacattgcagaaatcactcaacgagatagagaaa
aaatcaaagaatatgtcgaaagttcaaagttcttaacttacaccatgcttgctgaaagat
ttggaattagcaaaagctacttatctttaattttaaacggtaaaaagacttctgcagaag
caaacagaattatagattcgattatcactatgtacgaattgtaaagggaggaacagctaa
tgcaatatctagaagcaaaaatcccaattccagaaggctatgtaattatctcccaagtgg
attatgaggagttaaaaaaagctgatgatactggtagatggatgacgttgccagaagtgc
tagaacggattaacagaaaatatgattggtttacttctagagttttaaagaacccaagat
atagaaatattatcgatatcgaaaaaaacaaaaatggatttgtctattatccagttgaag
gaagagacacatatctatttttaagaagtaaaacacttgaatttttagaaacaaattttt
cggaaatcttaaggaggcaagcggatgggaaaatttaatagagcgctagtattcagcgca
ccgctaatcatctacgctttaggactttggggaagcagacaagcgttgataggaacgatt
gtttacatggtttggatttttatggggctggatgaagctgagtacaaaacaaaaaagcca
gtcg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|333849.6.peg.4321 Enterococcus faecium DO FIG   hypothetical protein
fig|333849.6.peg.492 Enterococcus faecium DO FIG   hypothetical protein
fig|535206.4.peg.1043 Enterococcus faecium E1162 FIG   hypothetical protein
fig|544875.4.peg.2518 Enterococcus faecium E1636 FIG   hypothetical protein
fig|547468.4.peg.967 Enterococcus faecium U0317 FIG   hypothetical protein
fig|565656.3.peg.1377 Enterococcus faecium 1,230,933 FIG   hypothetical protein
fig|565657.5.peg.874 Enterococcus faecium 1,231,502 FIG   hypothetical protein
fig|565660.4.peg.1838 Enterococcus faecium 1,231,410 FIG   hypothetical protein
fig|565660.4.peg.784 Enterococcus faecium 1,231,410 FIG   hypothetical protein
fig|565661.4.peg.2041 Enterococcus faecium 1,231,408 FIG   hypothetical protein
fig|565664.3.peg.2419 Enterococcus faecium C68 FIG   hypothetical protein
fig|565664.3.peg.639 Enterococcus faecium C68 FIG   hypothetical protein
fig|565665.3.peg.1939 Enterococcus faecium D344SRF FIG   hypothetical protein
fig|565666.3.peg.1822 Enterococcus faecium TC 6 FIG   hypothetical protein
gb|EEV42452.1 Enterococcus faecium 1,230,933     predicted protein
gb|EEV44721.1 Enterococcus faecium 1,231,502     predicted protein
gb|EEV53211.1 Enterococcus faecium 1,231,410     predicted protein
gb|EEV54031.1 Enterococcus faecium 1,231,410     predicted protein
gb|EEV57284.1 Enterococcus faecium 1,231,408     predicted protein
gb|EEV62088.1 Enterococcus faecium Com15     predicted protein
gi|257813694 Enterococcus faecium 1,230,933 NCBI   predicted protein
gi|257817393 Enterococcus faecium 1,231,502 NCBI   predicted protein
gi|257826585 Enterococcus faecium 1,231,410 NCBI   predicted protein
gi|257827405 Enterococcus faecium 1,231,410 NCBI   predicted protein
gi|257830677 Enterococcus faecium 1,231,408 NCBI   predicted protein
gi|257837014 Enterococcus faecium Com15 NCBI   predicted protein
gi|257879466 Enterococcus faecium 1,230,933 NCBI   predicted protein
gi|257881735 Enterococcus faecium 1,231,502 NCBI   predicted protein
gi|257890225 Enterococcus faecium 1,231,410 NCBI   predicted protein
gi|257891045 Enterococcus faecium 1,231,410 NCBI   predicted protein
gi|257894298 Enterococcus faecium 1,231,408 NCBI   predicted protein
gi|257899102 Enterococcus faecium Com15 NCBI   predicted protein
gi|258615810 Enterococcus faecium DO NCBI   hypothetical protein EfaeD_08871
ref|ZP_05659119.1 Enterococcus faecium 1,230,933 RefSeq   predicted protein
ref|ZP_05661388.1 Enterococcus faecium 1,231,502 RefSeq   predicted protein
ref|ZP_05669878.1 Enterococcus faecium 1,231,410 RefSeq   predicted protein
ref|ZP_05670698.1 Enterococcus faecium 1,231,410 RefSeq   predicted protein
ref|ZP_05673951.1 Enterococcus faecium 1,231,408 RefSeq   predicted protein
ref|ZP_05678755.1 Enterococcus faecium Com15 RefSeq   predicted protein
ref|ZP_05713580.1 Enterococcus faecium DO RefSeq   hypothetical protein EfaeD_08871


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search