The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|565663.4.peg.1411: Enterococcus faecium Com15

This feature in The SEED Viewer

NCBI Taxonomy Id: 565663

Current Assignment: Uncharacterized phage-encoded protein-like
Translate Function Assignments



Context on contig NZ_GG670326 from base 156624 to 167094 (10471 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1400 157319 156624 696 -           C-5 cytosine-specific DNA methylase  
1401 157777 157355 423 - 35         FIG00631830: hypothetical protein  
1402 157917 157774 144 - -4         hypothetical protein  
1403 158216 157917 300 - -1         FIG00631516: hypothetical protein  
1404 158380 158219 162 - 2         FIG00630198: hypothetical protein  
1405 158836 158672 165 - 291         FIG00632008: hypothetical protein  
1406 159110 158841 270 - 4         hypothetical protein  
1407 159871 159122 750 - 11         Phage replication initiation  
1408 160560 159874 687 - 2         Phage protein  
1409 161300 160566 735 - 5         Phage protein  
1410 161634 161293 342 - -8         FIG00627384: hypothetical protein  
1411 162510 161812 699 - 177       Uncharacterized phage-encoded protein-like  
1412 162565 163230 666 + 54         hypothetical protein  
1413 163498 163328 171 - 97         FIG00631288: hypothetical protein  
1414 163823 163485 339 - -14         FIG00628305: hypothetical protein  
1415 164042 163839 204 - 15         hypothetical protein  
1416 164839 164057 783 - 14         Phage antirepressor protein  
1417 164900 165520 621 + 60         hypothetical protein  
1418 166219 166061 159 - 540         hypothetical protein  
1419 166416 166231 186 - 11         cro  
1420 166720 167094 375 + 303 4     Phage transcriptional regulator, Cro/CI family  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|565663.4.peg.1411 Uncharacterized phage-encoded protein-like
MQELVILKNKEAVTTSLQVADSFEKEHKNVLRDIEKLKEDVLNFEQMFVEGNEPDSYGRN
RRVFFISRDGFFLLAMGFTGKKAIYFKQKYIEAFNEMEDVIRKNTVPQTIEDMMIYQLEE
MKDVKKDVSMLKDTMRISGQQEFEIKQKGNIKVMEVLGGKESRAYEEISKKVFSKFWSEF
KRTFSIPRYGELPRKRFDDAVSFIEMWLPETAIRMEIDQLNRQQRLFGDDNE

MD5 = f816d02daadcf01316fbde92f75b6e4e


  DNA Sequence

>fig|565663.4.peg.1411 Uncharacterized phage-encoded protein-like
atgcaagaattagtaattttgaaaaataaagaagctgtgactacgagtttgcaagtcgca
gatagttttgaaaaagaacacaaaaatgttttgagagatattgaaaagttaaaagaagat
gtgctcaattttgagcagatgtttgtggaaggtaatgaaccagattcatacggcagaaat
cgacgagttttcttcattagtagagatggttttttcttgttggctatgggttttacagga
aagaaagctatttacttcaaacaaaaatacattgaagcattcaacgaaatggaagatgtt
attcgcaagaatactgttcctcaaacaattgaagatatgatgatctaccaactagaagaa
atgaaagatgttaaaaaagatgtttccatgcttaaagatactatgcgaattagtgggcaa
caagagtttgaaattaagcaaaaaggaaatataaaagttatggaagttctagggggtaaa
gaaagccgagcttatgaagaaatcagcaaaaaagtattctcaaaattttggtctgaattt
aaacgtaccttttcaatcccaagatatggcgagttacctcgtaagagattcgatgatgct
gtttcatttattgaaatgtggttgccagaaactgcgatccgtatggaaattgatcaactg
aacagacaacagagactttttggtgatgacaatgaatag


  DNA with Flanking Sequence

>fig|565663.4.peg.1411 Uncharacterized phage-encoded protein-like
gatagatcagcacctttttttaaagatttaccagaatacgcacgtataccatgtggaagt
tcgtcatacattgattttaccgttacagaataattatcaccaatcattgtaaaagcattt
aaaggatcaggaattccagaaatcgaaaactcaataattgtaacaggtaaagaactgtta
tttgttaacaatacagaatctataatcctgaatttattttgatggtaaacatctggtttg
gaatcactttctctatctatcaaccattcttcgcattcagcgaagaaatccaattttaaa
ttaaattttttgttttttctatctgtataggagatataaaaagcaaatgttgaaaatact
agagacgtaataggcaaaataaaatctttaatggttttaacaatgttattccagtcaaat
tgtttaataaagtcaataagactcaatttataccaccaccattttttatctacattatat
caaagaggagagaagaaataatgcaagaattagtaattttgaaaaataaagaagctgtga
ctacgagtttgcaagtcgcagatagttttgaaaaagaacacaaaaatgttttgagagata
ttgaaaagttaaaagaagatgtgctcaattttgagcagatgtttgtggaaggtaatgaac
cagattcatacggcagaaatcgacgagttttcttcattagtagagatggttttttcttgt
tggctatgggttttacaggaaagaaagctatttacttcaaacaaaaatacattgaagcat
tcaacgaaatggaagatgttattcgcaagaatactgttcctcaaacaattgaagatatga
tgatctaccaactagaagaaatgaaagatgttaaaaaagatgtttccatgcttaaagata
ctatgcgaattagtgggcaacaagagtttgaaattaagcaaaaaggaaatataaaagtta
tggaagttctagggggtaaagaaagccgagcttatgaagaaatcagcaaaaaagtattct
caaaattttggtctgaatttaaacgtaccttttcaatcccaagatatggcgagttacctc
gtaagagattcgatgatgctgtttcatttattgaaatgtggttgccagaaactgcgatcc
gtatggaaattgatcaactgaacagacaacagagactttttggtgatgacaatgaataga
gctgaagcgctaagaatagggacggcaattgctaattgctggtggaaatactataaacca
atcatcctaagccaacaacatattgacaagcaaaaagcatggcaacaaataaaaaagtga
ctccgcctgcaagcaaagagtcacaaagaaaacacatcataaggagattttagcatatgg
aaaaagaactttccactctagatcaatatttgattgatcctgattggggcaagccgaaaa
ttgaggaaacaagtggtcgaaaaatcagacgaaatcttttgacgaatgaagaactagctt
gtgatcaagatggtttaggcaaccttgtaactatttgggatcatgtttatcttatccatc
tatcgaagcattcgaataaacctgaatatatttacgtcatcgaagatggcttgattgatg
cgctagaagagtacgacagagataacttgattgatatctcttattacggaccaggtaaga
aatacattgctgaaatgga


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
gb|EEV62083.1 Enterococcus faecium Com15     phage anti-repressor protein
gi|257837009 Enterococcus faecium Com15 NCBI   phage anti-repressor protein
gi|257899097 Enterococcus faecium Com15 NCBI   phage anti-repressor protein
ref|ZP_05678750.1 Enterococcus faecium Com15 RefSeq   phage anti-repressor protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|565663.4.peg.1420 Phage transcriptional regulator, Cro/CI family


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search