The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|565663.4.peg.1399: Enterococcus faecium Com15

This feature in The SEED Viewer

NCBI Taxonomy Id: 565663

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NZ_GG670326 from base 149745 to 161634 (11890 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1388 151535 149745 1791 -           Phage terminase large subunit  
1389 151981 151526 456 - -10         Phage terminase-like protein, small subunit  
1390 152032 152253 222 + 50         hypothetical protein  
1391 153431 152859 573 - 605         FIG00633209: hypothetical protein  
1392 153756 153472 285 - 40         FIG00627746: hypothetical protein  
1393 153866 153753 114 - -4         hypothetical protein  
1394 154199 153987 213 - 120         hypothetical protein  
1395 155196 155044 153 - 844         hypothetical protein  
1396 155737 155456 282 - 259         Phage transcriptional activator ArpU  
1397 156121 155963 159 - 225         hypothetical protein  
1398 156410 156111 300 - -11         FIG00631129: hypothetical protein  
1399 156610 156407 204 - -4         hypothetical protein  
1400 157319 156624 696 - 13         C-5 cytosine-specific DNA methylase  
1401 157777 157355 423 - 35         FIG00631830: hypothetical protein  
1402 157917 157774 144 - -4         hypothetical protein  
1403 158216 157917 300 - -1         FIG00631516: hypothetical protein  
1404 158380 158219 162 - 2         FIG00630198: hypothetical protein  
1405 158836 158672 165 - 291         FIG00632008: hypothetical protein  
1406 159110 158841 270 - 4         hypothetical protein  
1407 159871 159122 750 - 11         Phage replication initiation  
1408 160560 159874 687 - 2         Phage protein  
1409 161300 160566 735 - 5         Phage protein  
1410 161634 161293 342 - -8         FIG00627384: hypothetical protein  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|565663.4.peg.1399 hypothetical protein
MNNRHRRVAKLKKQELNALKAKFEKEYGVSVEEAYNVASQCVADASDAIRKFGISILSDD
RKWEDKE

MD5 = 2814a447e0668689f76cfd4752eb01e8


  DNA Sequence

>fig|565663.4.peg.1399 hypothetical protein
atgaacaacagacaccgcagagtagcaaaactaaaaaaacaagaactgaatgcactaaag
gcaaagtttgaaaaagaatacggagtttcagtagaagaagcatacaatgtggcaagtcag
tgtgttgctgatgcaagtgatgctattcgtaagtttggaatttcgatattaagtgatgat
cgtaaatgggaggataaagaatga


  DNA with Flanking Sequence

>fig|565663.4.peg.1399 hypothetical protein
cggtaatgcttcctggaaacaagaacaaggtgatggattatttgagccacagattccgtt
atccagatttacggtaagagactatgaagattacagcggatatcagtttaagccggaaaa
atctttgataaatcgtattaatggagagctttgtacatttaataccattcagataatcaa
gaggtatcagcctagaatttacgtgatcgaaaatccggcaagcagtcggatgtgggaata
tattgaacgagtgttaggatttcacattcctttttataatctgacttactacaacaatta
tgactatccaattagcaaagcaacaaaatttaaaagtaatgtccaattggatttaaagaa
gcaaaagattagaaatgacgtgaagtttaatgagtttagtagaaattacaacgaacgttc
aaatattccattgaaattagtaacagccatatttgaacaattagagaggcagttacaaga
ggtatgagggaggaatcataatgaacaacagacaccgcagagtagcaaaactaaaaaaac
aagaactgaatgcactaaaggcaaagtttgaaaaagaatacggagtttcagtagaagaag
catacaatgtggcaagtcagtgtgttgctgatgcaagtgatgctattcgtaagtttggaa
tttcgatattaagtgatgatcgtaaatgggaggataaagaatgaaactaaaagacggatt
ttacgctagtagtcatggtatcggcggtttaatgctagatatgccgacaaagaatcctaa
aaaacgtaagaaaccaaaagtcaaagtcggtgacatggttcgctgcgaagcagaaggatt
catctatccatttcgtggatatgtagaacatgtctataatcactcagcaatcattcgtat
tgaaaacacgatggaatgtgacaagtggttagcgaaaagcaaagagaatttagctgtagc
gagattggtggatatggaggttataaacaatggaatttaaaatctttgaagaggacacac
gctatgaattagaagaaaaattaaatgaatttgcaaagaataatgaaattcagcatatat
ctttaacggcttctaagtccggttgtacaacttactatgcagctgttgtgagctacgtaa
gtcaataaaaggaactcgacaaataaaaaagccggatcgctccgactgattcaataaatc
caac


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
gb|EEV62073.1 Enterococcus faecium Com15     predicted protein
gi|257836999 Enterococcus faecium Com15 NCBI   predicted protein
gi|257899087 Enterococcus faecium Com15 NCBI   predicted protein
ref|ZP_05678740.1 Enterococcus faecium Com15 RefSeq   predicted protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search