The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|557433.3.peg.823: Lactobacillus reuteri JCM 1112

This feature in The SEED Viewer

NCBI Taxonomy Id: 557433

Current Assignment: transcriptional regulator, XRE family
Translate Function Assignments



Context on contig NC_010609 from base 877221 to 887951 (10731 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
816 878357 877221 1137 -       1: 1 ff
icw(1)
ilit(
3020045)
ilit(7584049)
isu
Gluconate permease, Bsu4004 homolog locus|LAR_0765, protein_id|YP_001841761.1, gi|184153420, geneID|6230305
817 879728 878463 1266 - 105 4     Phage integrase (Site-specific recombinase) locus|LAR_0766, protein_id|YP_001841762.1, gi|184153421, geneID|6230306
818 880043 880195 153 + 314         hypothetical protein  
819 881053 880196 858 - 0       ff hypothetical protein locus|LAR_0767, protein_id|YP_001841763.1, gi|184153422, geneID|6230307
820 881595 881074 522 - 20         hypothetical protein locus|LAR_0768, protein_id|YP_001841764.1, gi|184153423, geneID|6230308
821 882013 881609 405 - 13       ff hypothetical protein locus|LAR_0769, protein_id|YP_001841765.1, gi|184153424, geneID|6230309
822 882471 882067 405 - 53       ff hypothetical protein locus|LAR_0770, protein_id|YP_001841766.1, gi|184153425, geneID|6230310
823 882778 882488 291 - 16     cwn transcriptional regulator, XRE family  
824 882984 883199 216 + 205         hypothetical protein locus|LAR_0771, protein_id|YP_001841767.1, gi|184153426, geneID|6230311
825 883218 883991 774 + 18 6   cwn Phage antirepressor protein locus|LAR_0772, protein_id|YP_001841768.1, gi|184153427, geneID|6230312
826 884003 884131 129 + 11       ff hypothetical protein  
827 884131 884253 123 + -1         hypothetical protein  
828 884267 884470 204 + 13       ff hypothetical protein locus|LAR_0773, protein_id|YP_001841769.1, gi|184153428, geneID|6230313
829 884911 885087 177 + 440       ff hypothetical protein locus|LAR_0774, protein_id|YP_001841770.1, gi|184153429, geneID|6230314
830 885352 886281 930 + 264     1: 2 ff
idu(2)
Recombinational DNA repair protein RecT (prophage associated) locus|LAR_0775, protein_id|YP_001841771.1, gi|184153430, geneID|6230315
831 886316 887089 774 + 34         Prophage Lp1 protein 19 locus|LAR_0776, protein_id|YP_001841772.1, gi|184153431, geneID|6230316
832 887094 887951 858 + 4         primosome, DnaD subunit locus|LAR_0777, protein_id|YP_001841773.1, gi|184153432, geneID|6230317

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|557433.3.peg.823 transcriptional regulator, XRE family
MSQFQLAKVLGIGTSTLGMYETNKRKPSPKVLNKIADYFDVSTDYLLGRKSKADQVHNAT
VDEALGTIMSFEGQPVTEHDKKVMKDLLESYLRNKE

MD5 = 3a8d3c4a6d78e4c6e56ca27a2e9bdea1


  DNA Sequence

>fig|557433.3.peg.823 transcriptional regulator, XRE family
atgtcacaattccaattagcaaaagtattaggaattggaacaagcactttaggaatgtac
gaaacgaataaaagaaagcctagccctaaagtcttaaataaaatagctgattatttcgat
gtttctactgattatttattagggcgcaagagtaaagcagatcaagtacataatgcgact
gttgatgaagctctcggaacaattatgtcattcgaaggccaacccgttactgaacatgat
aagaaagtaatgaaagatttactagaaagttatctcagaaataaagagtaa


  DNA with Flanking Sequence

>fig|557433.3.peg.823 transcriptional regulator, XRE family
gttcattgttaatagttactgtgcggacttgctgtccgttaaaattaaatagttgttgca
tttgattacctccttatcactaagagtgacaattaactgcaaaaaaaatagtgtccactg
acttatcgtagtagttagcaatcttgattttagtgtcatcgctgcctttacgataaccag
cttcaagcatagcgagcattgattgtgaaataccaatattcttagctgcttgagcctgag
attcacctttttcatgtctcaaatcaattaagactttgttaggtgtgacgctcatcacat
cgcctccttatcactaagagtgatttatcttacggctattataatatatcactaatagtg
ataagtcaaccacttttagtgactattttgatatttctttcatcacaaatagtgatatga
ttatcacagttagtaattataagaaggtgaaggatatgtccataggtaatagaatagccg
atttaaggacaaataatcatatgtcacaattccaattagcaaaagtattaggaattggaa
caagcactttaggaatgtacgaaacgaataaaagaaagcctagccctaaagtcttaaata
aaatagctgattatttcgatgtttctactgattatttattagggcgcaagagtaaagcag
atcaagtacataatgcgactgttgatgaagctctcggaacaattatgtcattcgaaggcc
aacccgttactgaacatgataagaaagtaatgaaagatttactagaaagttatctcagaa
ataaagagtaaaaggtcgccctgctttatggataataagttgaaagaacttctcgaagaa
ttgaatgccgtagtaatgtatggaagccttgattgcccgggacgcattgcttttccacct
attttagaagggaaagcagttatatacatagatactaaattaactgaaactcagcaaaaa
acagttttaattcatgaattaggtcatcttgctaagcaacgtgacgaaaaagaactttat
gatgtaacaatttctatgaagatgaaaatggaatatggcgctaacaaatttatgattaaa
taccttttctctaattacattgacgtcactggcgatgatccacactcggtgaattatctt
gagtttatgcgccaaaacgatatcccgtcgcgcgatgaaaatattgttaaagaagttatc
ttaaattattaatatacgtccaagcgtgatcgacgttaaaagctatacgggggagaaata
gattaatgaaatgctttgtatgcaaaaataa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|548485.3.peg.1191 Lactobacillus reuteri MM4-1A FIG   transcriptional regulator, XRE family
fig|557433.4.peg.824 Lactobacillus reuteri JCM 1112 FIG   transcriptional regulator, XRE family
fig|557436.4.peg.817 Lactobacillus reuteri DSM 20016 FIG   transcriptional regulator, XRE family
fig|585517.3.peg.1442 Lactobacillus reuteri MM2-3 FIG   transcriptional regulator, XRE family


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|557433.3.peg.817 Phage integrase (Site-specific recombinase)
6 fig|557433.3.peg.825 Phage antirepressor protein


  Attributes

Help on Attributes

Key
Link Explains Key
Value
evidence_code cwn


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search