The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|553590.4.peg.97: Staphylococcus aureus A9754

This feature in The SEED Viewer

NCBI Taxonomy Id: 553590

Current Assignment: GNAT family acetyltransferase YjcF
Translate Function Assignments



Context on contig NZ_ADJI01000001 from base 101785 to 114947 (13163 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
94 102795 101785 1011 -           membrane protein, putative locus|SKAG_00094, protein_id|ZP_06788784.1, gi|294848037
95 102948 103367 420 + 152         Putative ATL autolysin transcription regulator locus|SKAG_00095, protein_id|ZP_06788785.1, gi|294848038
96 107344 103574 3771 - 206     3: 3 8 6   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28)/ endo-beta-N-acetylglucosaminidase (EC 3.2.1.96) locus|SKAG_00097, protein_id|ZP_06788787.1, gi|294848040
97 108006 107572 435 - 227         GNAT family acetyltransferase YjcF locus|SKAG_00098, protein_id|ZP_06788788.1, gi|294848041
98 108631 108161 471 - 154         FIG01108206: hypothetical protein locus|SKAG_00099, protein_id|ZP_06788789.1, gi|294848042
99 109431 108679 753 - 47     1: 3   Cell envelope-associated transcriptional attenuator LytR-CpsA-Psr, subfamily F2 (as in PMID19099556) locus|SKAG_00100, protein_id|ZP_06788790.1, gi|294848043
100 110347 111540 1194 + 915     2: 7 3   FmtA protein involved in methicillin resistance locus|SKAG_00101, protein_id|ZP_06788791.1, gi|294848044
101 112355 112077 279 - 536     3: 4 2 1   AA3-600 quinol oxidase subunit IV locus|SKAG_00102, protein_id|ZP_06788792.1, gi|294848045
102 112969 112364 606 - 8     4: 4 2 5 1   AA3-600 quinol oxidase subunit IIII locus|SKAG_00103, protein_id|ZP_06788793.1, gi|294848046
103 114947 112959 1989 - -11     4: 4 2 5 1   AA3-600 quinol oxidase subunit I locus|SKAG_00104, protein_id|ZP_06788794.1, gi|294848047

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|553590.4.peg.97 GNAT family acetyltransferase YjcF
MFSKVNNQKMLEDCFYIRKKVFVEEQGVPEESEIDEYESESIHLIGYDNGQPVATARIRP
INETTVKIERVAVMKSHRGQGMGRMLMQAVESLAKDEGFYVATMNAQCHAIPFYESLNFK
MRGNIFLEEGIEHIEMTKKLTSLN

MD5 = 4e5af17405bc93fa4217e36504d34852


  DNA Sequence

>fig|553590.4.peg.97 GNAT family acetyltransferase YjcF
atgttttcaaaagtaaacaatcaaaagatgttagaagattgcttctatataagaaagaaa
gtgtttgtagaagaacaaggcgtccctgaggaaagtgaaattgatgaatatgaatctgaa
tctattcacctcattggatatgataatggacagccagttgccactgctcgaatacgccct
attaatgaaacaactgtcaaaatagaacgagtagctgtgatgaaatcacatcgtggacaa
ggaatgggtagaatgcttatgcaagctgtagaatcattagctaaagatgaaggtttttac
gtagctactatgaatgcccaatgtcatgctatcccattttatgaaagtttaaactttaaa
atgagaggtaatatatttcttgaggaaggcatcgagcatattgaaatgacaaaaaagtta
acctcgcttaattaa


  DNA with Flanking Sequence

>fig|553590.4.peg.97 GNAT family acetyltransferase YjcF
gcatcgagaaaactatgaagcactcctaatttattacaaaaatagtatcgacaatcctat
tgtagatggtgcatgttatattttagccctacctgaaattttcaatagtgttgatgtttt
cgaatcagagttaccattttcatgggtatatgatgaaaatggcattaccgaaacaatgaa
atcacttagcattccattacaatatttagttgcagcagctttagaagtaactgatgtgaa
tatatttaagccttcaggatttacaatgggaatgaataattggaatattgctcaaatgcg
aatcttttggcaatatacagcaattattagaaaagaagcactataacattaataattaat
tagctataaagatgattcacaacaatcatctttatagcttttttatgtctaattattttt
gaggaaaataacaatcgttattctatgttattattagtaaattaaatgtaaatgattttg
ttaggatgtggaggaattttatgttttcaaaagtaaacaatcaaaagatgttagaagatt
gcttctatataagaaagaaagtgtttgtagaagaacaaggcgtccctgaggaaagtgaaa
ttgatgaatatgaatctgaatctattcacctcattggatatgataatggacagccagttg
ccactgctcgaatacgccctattaatgaaacaactgtcaaaatagaacgagtagctgtga
tgaaatcacatcgtggacaaggaatgggtagaatgcttatgcaagctgtagaatcattag
ctaaagatgaaggtttttacgtagctactatgaatgcccaatgtcatgctatcccatttt
atgaaagtttaaactttaaaatgagaggtaatatatttcttgaggaaggcatcgagcata
ttgaaatgacaaaaaagttaacctcgcttaattaaaaaaagttgtatctattttagaaac
atttgtaataaaccaattcttaaattgacatcaattctatttgatttgtcacgtcaccat
tgagattcaaaatttttttcatttttttacagtgaaaatgtaaattaagagtatattaca
aattggttaaatacgcacaggtatataaaacaggtactataatgttagtaataattaata
aatgttaggagtaataaatagaatggcgaaaaaattcaattacaaactaccatcaatggt
tgcattaacgcttgtaggttcagcagtcactgcacatcaagttcaagcagctgagacgac
acaagatcaaactactaataaaaacgttttagatagtaataaagttaaagcaactactga
acaagcaaaagctgaggtaaaaaatccaacgcaaaacatttctggcactcaagtatatca
agaccctgctattgtccaaccaaaaacagcaaataacaaaacaggcaatgctcaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0008080       F:N-acetyltransferase activity
GO:0008152       P:metabolic process
cmr|NT01SA0986 Staphylococcus aureus N315     acetyltransferase, GNAT family
cmr|NT02SA1044 Staphylococcus aureus Mu50     acetyl transferase
cmr|NT03SA1023 Staphylococcus aureus MW2     elaA protein
cmr|NT05SA0901 Staphylococcus aureus NCTC 8325     acetyl transferase
cmr|NT09SA0986 Staphylococcus aureus subsp. aureus MSSA476     acetyl transferase
cmr|SACOL1063 Staphylococcus aureus subsp. aureus COL     acetyltransferase, GNAT family
cmr|SAUSA300_0956 Staphylococcus aureus subsp. aureus USA300-FPR3757     conserved hypothetical protein
dbj|BAA04184.1 Staphylococcus aureus     ORF3
dbj|BAB42151.1 Staphylococcus aureus subsp. aureus N315     conserved hypothetical protein
dbj|BAB57216.1 Staphylococcus aureus subsp. aureus Mu50     putative acetyltransferase
dbj|BAB94802.1 Staphylococcus aureus subsp. aureus MW2     conserved hypothetical protein
dbj|BAF67195.1 Staphylococcus aureus subsp. aureus str. Newman     acetyltransferase, GNAT family protein
dbj|BAF77929.1 Staphylococcus aureus subsp. aureus Mu3     conserved hypothetical protein
emb|CAG42764.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   acetyltransferase (GNAT) family protein
fig|158878.1.peg.1054 Staphylococcus aureus subsp. aureus Mu50 FIG   GNAT family acetyltransferase YjcF
fig|158878.14.peg.1080 Staphylococcus aureus subsp. aureus Mu50 FIG   GNAT family acetyltransferase YjcF
fig|158879.1.peg.934 Staphylococcus aureus subsp. aureus N315 FIG   GNAT family acetyltransferase YjcF
fig|158879.11.peg.968 Staphylococcus aureus subsp. aureus N315 FIG   GNAT family acetyltransferase YjcF
fig|196620.1.peg.937 Staphylococcus aureus subsp. aureus MW2 FIG   GNAT family acetyltransferase YjcF
fig|196620.5.peg.982 Staphylococcus aureus subsp. aureus MW2 FIG   GNAT family acetyltransferase YjcF
fig|282459.1.peg.981 Staphylococcus aureus subsp. aureus MSSA476 FIG   GNAT family acetyltransferase YjcF
fig|282459.5.peg.1025 Staphylococcus aureus subsp. aureus MSSA476 FIG   GNAT family acetyltransferase YjcF
fig|359786.13.peg.1185 Staphylococcus aureus subsp. aureus JH9 FIG   GNAT family acetyltransferase YjcF
fig|359786.3.peg.2349 Staphylococcus aureus subsp. aureus JH9 FIG   GNAT family acetyltransferase YjcF
fig|359787.11.peg.1166 Staphylococcus aureus subsp. aureus JH1 FIG   GNAT family acetyltransferase YjcF
fig|359787.3.peg.1594 Staphylococcus aureus subsp. aureus JH1 FIG   GNAT family acetyltransferase YjcF
fig|367830.3.peg.1521 Staphylococcus aureus subsp. aureus USA300 FIG   GNAT family acetyltransferase YjcF
fig|418127.4.peg.963 Staphylococcus aureus subsp. aureus Mu3 FIG   GNAT family acetyltransferase YjcF
fig|418127.6.peg.1063 Staphylococcus aureus subsp. aureus Mu3 FIG   GNAT family acetyltransferase YjcF
fig|426430.6.peg.892 Staphylococcus aureus subsp. aureus str. Newman FIG   GNAT family acetyltransferase YjcF
fig|426430.8.peg.997 Staphylococcus aureus subsp. aureus str. Newman FIG   GNAT family acetyltransferase YjcF
fig|451515.3.peg.1049 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   GNAT family acetyltransferase YjcF
fig|451516.9.peg.1053 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   GNAT family acetyltransferase YjcF
fig|452948.4.peg.2065 Staphylococcus aureus 930918-3 FIG   GNAT family acetyltransferase YjcF
fig|455227.3.peg.1414 Staphylococcus aureus D30 FIG   GNAT family acetyltransferase YjcF
fig|505321.3.peg.1740 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   GNAT family acetyltransferase YjcF
fig|546342.3.peg.1023 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   GNAT family acetyltransferase YjcF
fig|546343.3.peg.1890 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   GNAT family acetyltransferase YjcF
fig|548475.3.peg.1285 Staphylococcus aureus subsp. aureus TCH70 FIG   GNAT family acetyltransferase YjcF
fig|553565.3.peg.1751 Staphylococcus aureus A5937 FIG   GNAT family acetyltransferase YjcF
fig|553567.3.peg.1495 Staphylococcus aureus A5948 FIG   GNAT family acetyltransferase YjcF
fig|553568.3.peg.2237 Staphylococcus aureus A6224 FIG   GNAT family acetyltransferase YjcF
fig|553571.3.peg.1967 Staphylococcus aureus A6300 FIG   GNAT family acetyltransferase YjcF
fig|553573.3.peg.1099 Staphylococcus aureus A8115 FIG   GNAT family acetyltransferase YjcF
fig|553574.3.peg.1416 Staphylococcus aureus A8117 FIG   GNAT family acetyltransferase YjcF
fig|553577.3.peg.1520 Staphylococcus aureus A8796 FIG   GNAT family acetyltransferase YjcF
fig|553580.3.peg.1000 Staphylococcus aureus A8819 FIG   GNAT family acetyltransferase YjcF
fig|553581.3.peg.1007 Staphylococcus aureus A9299 FIG   GNAT family acetyltransferase YjcF
fig|553588.3.peg.2164 Staphylococcus aureus A9719 FIG   GNAT family acetyltransferase YjcF
fig|553592.3.peg.201 Staphylococcus aureus A9763 FIG   GNAT family acetyltransferase YjcF
fig|553594.3.peg.2036 Staphylococcus aureus A9765 FIG   GNAT family acetyltransferase YjcF
fig|553596.3.peg.2137 Staphylococcus aureus A9781 FIG   GNAT family acetyltransferase YjcF
fig|553601.3.peg.904 Staphylococcus aureus A10102 FIG   GNAT family acetyltransferase YjcF
fig|585891.3.peg.1077 Staphylococcus aureus subsp. aureus Mu50-omega FIG   GNAT family acetyltransferase YjcF
fig|644279.4.peg.1058 Staphylococcus aureus subsp. aureus 132 FIG   GNAT family acetyltransferase YjcF
fig|680649.3.peg.2413 Staphylococcus aureus subsp. aureus MR1 FIG   GNAT family acetyltransferase YjcF
fig|681288.4.peg.1022 Staphylococcus aureus subsp. aureus ED98 FIG   GNAT family acetyltransferase YjcF
fig|703339.3.peg.1022 Staphylococcus aureus 04-02981 FIG   GNAT family acetyltransferase YjcF
fig|762962.3.peg.1015 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   GNAT family acetyltransferase YjcF
fig|93061.3.peg.956 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   GNAT family acetyltransferase YjcF
fig|93061.5.peg.913 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   GNAT family acetyltransferase YjcF
fig|93062.19.peg.1033 Staphylococcus aureus subsp. aureus COL FIG   GNAT family acetyltransferase YjcF
fig|93062.4.peg.1231 Staphylococcus aureus subsp. aureus COL FIG   GNAT family acetyltransferase YjcF
gb|AAA99981.1 Staphylococcus aureus     ORF3
gb|AAW36527.1 Staphylococcus aureus subsp. aureus COL     acetyltransferase, GNAT family
gb|ABD21960.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     conserved hypothetical protein
gb|ABD30119.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABQ48913.1 Staphylococcus aureus subsp. aureus JH9     GCN5-related N-acetyltransferase
gb|ABR51990.1 Staphylococcus aureus subsp. aureus JH1     GCN5-related N-acetyltransferase
gb|EEV83044.1 Staphylococcus aureus A5948     acetyl transferase
gb|EEV85642.1 Staphylococcus aureus A5937     acetyl transferase
gb|EEW44337.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1109
gb|EEW47070.1 Staphylococcus aureus D30     hypothetical protein SAD30_2043
gi|13700855 Staphylococcus aureus subsp. aureus N315 NCBI   conserved hypothetical protein
gi|14246824 Staphylococcus aureus subsp. aureus Mu50 NCBI   putative acetyltransferase
gi|147740615 Staphylococcus aureus subsp. aureus JH9 NCBI   GCN5-related N-acetyltransferase
gi|148267546 Staphylococcus aureus subsp. aureus JH9 NCBI   GCN5-related N-acetyltransferase
gi|149946054 Staphylococcus aureus subsp. aureus JH1 NCBI   GCN5-related N-acetyltransferase
gi|150373935 Staphylococcus aureus subsp. aureus str. Newman NCBI   acetyltransferase, GNAT family protein
gi|150393602 Staphylococcus aureus subsp. aureus JH1 NCBI   GCN5-related N-acetyltransferase
gi|151221135 Staphylococcus aureus subsp. aureus str. Newman NCBI   acetyltransferase, GNAT family protein
gi|156721512 Staphylococcus aureus subsp. aureus Mu3 NCBI   conserved hypothetical protein
gi|156979377 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_1046
gi|15924044 Staphylococcus aureus subsp. aureus Mu50 NCBI   acetyl transferase
gi|15926640 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA0906
gi|21204104 Staphylococcus aureus subsp. aureus MW2 NCBI   conserved hypothetical protein
gi|21282666 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW0937
gi|221138031 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_05163
gi|221141837 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_09431
gi|253316211 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   hypothetical protein SauraC_08742
gi|255005841 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_05210
gi|257860212 Staphylococcus aureus A5948 NCBI   acetyl transferase
gi|257862877 Staphylococcus aureus A5937 NCBI   acetyl transferase
gi|258451997 Staphylococcus aureus A5948 NCBI   acetyl transferase
gi|258454997 Staphylococcus aureus A5937 NCBI   acetyl transferase
gi|259159279 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1109
gi|259162501 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_2043
gi|49244336 Staphylococcus aureus subsp. aureus MSSA476 NCBI   acetyltransferase (GNAT) family protein
gi|49485893 Staphylococcus aureus subsp. aureus MSSA476 NCBI   acetyltransferase (GNAT) family protein
gi|57284433 Staphylococcus aureus subsp. aureus COL NCBI   acetyltransferase, GNAT family
gi|57650247 Staphylococcus aureus subsp. aureus COL NCBI   acetyltransferase
gi|60416278 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0039 protein SAV1054
gi|60416292 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0039 protein SA0906
gi|60416293 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0039 protein MW0937
gi|60416346 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0039 protein SAOUHSC_00995; AltName: Full=ORF3
gi|725453 Staphylococcus aureus NCBI   ORF3
gi|765072 Staphylococcus aureus NCBI   ORF3
gi|81649536 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0039 protein SAS0989
gi|81694786 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0039 protein SACOL1063
gi|87127446 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   conserved hypothetical protein
gi|87161472 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_0956
gi|87202309 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88194751 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_00995
img|637092553 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637099567 Staphylococcus aureus aureus Mu50 IMG   acetyl transferase
img|637151826 Staphylococcus aureus aureus COL IMG   acetyltransferase, GNAT family
img|637157217 Staphylococcus aureus aureus MSSA476 IMG   acetyltransferase (GNAT) family protein
img|637298700 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637887608 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637893640 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|639109239 Staphylococcus aureus aureus JH1 IMG   GCN5-related N-acetyltransferase
img|640565464 Staphylococcus aureus aureus JH9 IMG   GCN5-related N-acetyltransferase
img|640779223 Staphylococcus aureus aureus JH1 IMG   GCN5-related N-acetyltransferase
img|640795303 Staphylococcus aureus aureus Newman IMG   acetyltransferase, GNAT family protein
img|640903789 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
kegg|saa:SAUSA300_0956 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL1063 Staphylococcus aureus subsp. aureus COL KEGG   acetyltransferase
kegg|sae:NWMN_0923 Staphylococcus aureus subsp. aureus Newman KEGG   acetyltransferase, GNAT family protein
kegg|sah:SaurJH1_1136 Staphylococcus aureus subsp. aureus JH1 KEGG   GCN5-related N-acetyltransferase
kegg|saj:SaurJH9_1113 Staphylococcus aureus subsp. aureus JH9 KEGG   GCN5-related N-acetyltransferase
kegg|sam:MW0937 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_00995 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sas:SAS0989   KEGG   acetyltransferase (GNAT) family protein
kegg|sau:SA0906   KEGG   hypothetical protein
kegg|sav:SAV1054   KEGG   acetyl transferase
kegg|saw:SAHV_1046 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
ref|NP_371578.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   acetyl transferase
ref|NP_374173.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA0906
ref|NP_645754.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW0937
ref|YP_001246489.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   GCN5-related N-acetyltransferase
ref|YP_001316277.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   GCN5-related N-acetyltransferase
ref|YP_001331957.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   acetyltransferase, GNAT family protein
ref|YP_001441636.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_1046
ref|YP_043114.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   acetyltransferase (GNAT) family protein
ref|YP_185927.1 Staphylococcus aureus subsp. aureus COL RefSeq   acetyltransferase
ref|YP_493654.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_0956
ref|YP_499547.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_00995
ref|ZP_03562833.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_05163
ref|ZP_03566330.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_09431
ref|ZP_04839424.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   hypothetical protein SauraC_08742
ref|ZP_05144442.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_05210
ref|ZP_05700013.1 Staphylococcus aureus A5948 RefSeq   acetyl transferase
ref|ZP_05702960.1 Staphylococcus aureus A5937 RefSeq   acetyl transferase
sp|P0A0M6 Staphylococcus aureus (strain Mu50 / ATCC 700699) SwissProt   RecName: Full=UPF0039 protein SAV1054
sp|P0A0M7 Staphylococcus aureus (strain N315) SwissProt   RecName: Full=UPF0039 protein SA0906
sp|P0A0M8 Staphylococcus aureus (strain MW2) SwissProt   RecName: Full=UPF0039 protein MW0937
sp|P0A0M9 Staphylococcus aureus (strain NCTC 8325) SwissProt   RecName: Full=UPF0039 protein SAOUHSC_00995; AltName: Full=ORF3
sp|Q5HH30 Staphylococcus aureus (strain COL) SwissProt   RecName: Full=UPF0039 protein SACOL1063
sp|Q6GAF9 Staphylococcus aureus (strain MSSA476) SwissProt   RecName: Full=UPF0039 protein SAS0989
sp|Y1054_STAAM organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0039 protein SAV1054
sp|Y1063_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0039 protein SACOL1063
sp|Y906_STAAN organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0039 protein SA0906
sp|Y937_STAAW organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0039 protein MW0937
sp|Y989_STAAS organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0039 protein SAS0989
sp|Y995_STAA8 organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0039 protein SAOUHSC_00995; AltName: Full=ORF3
tr|A5IRU0 Staphylococcus aureus (strain JH9) TrEMBL   GCN5-related N-acetyltransferase
tr|A6QFR3 Staphylococcus aureus (strain Newman) TrEMBL   Acetyltransferase, GNAT family protein
tr|A6U0M2 Staphylococcus aureus (strain JH1) TrEMBL   GCN5-related N-acetyltransferase
tr|A7X0U1 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|Q2FI24 Staphylococcus aureus (strain USA300) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search