The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|553590.4.peg.96: Staphylococcus aureus A9754

This feature in The SEED Viewer

NCBI Taxonomy Id: 553590

Current Assignment: Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28)/ endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
Translate Function Assignments



Context on contig NZ_ADJI01000001 from base 97634 to 112355 (14722 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
91 98815 97634 1182 -           Staphopain B precursor (EC 3.4.22.-) locus|SKAG_00091, protein_id|ZP_06788781.1, gi|294848034
92 99907 98897 1011 - 81     1: 4 dlit(96922)
dlit(3306605)
Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA locus|SKAG_00092, protein_id|ZP_06788782.1, gi|294848035
93 101589 100435 1155 - 527     2: 9 6   N-acetyl-L,L-diaminopimelate aminotransferase (EC 2.6.1.-) locus|SKAG_00093, protein_id|ZP_06788783.1, gi|294848036
94 102795 101785 1011 - 195         membrane protein, putative locus|SKAG_00094, protein_id|ZP_06788784.1, gi|294848037
95 102948 103367 420 + 152         Putative ATL autolysin transcription regulator locus|SKAG_00095, protein_id|ZP_06788785.1, gi|294848038
96 107344 103574 3771 - 206     3: 1 8 2   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28)/ endo-beta-N-acetylglucosaminidase (EC 3.2.1.96) locus|SKAG_00097, protein_id|ZP_06788787.1, gi|294848040
97 108006 107572 435 - 227         GNAT family acetyltransferase YjcF locus|SKAG_00098, protein_id|ZP_06788788.1, gi|294848041
98 108631 108161 471 - 154         FIG01108206: hypothetical protein locus|SKAG_00099, protein_id|ZP_06788789.1, gi|294848042
99 109431 108679 753 - 47     1: 1   Cell envelope-associated transcriptional attenuator LytR-CpsA-Psr, subfamily F2 (as in PMID19099556) locus|SKAG_00100, protein_id|ZP_06788790.1, gi|294848043
100 110347 111540 1194 + 915     2: 3 1   FmtA protein involved in methicillin resistance locus|SKAG_00101, protein_id|ZP_06788791.1, gi|294848044
101 112355 112077 279 - 536     3: 10 5 7   AA3-600 quinol oxidase subunit IV locus|SKAG_00102, protein_id|ZP_06788792.1, gi|294848045

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Adhesins_in_Staphylococcus SvetaG Bifunctional autolysin Atl
Biofilm_formation_in_Staphylococcus SvetaG Bifunctional autolysin Atl
Cell_envelope-associated_LytR-CpsA-Psr_transcriptional_attenuators SvetaG *Bifunctional autolysin Atl


  Protein Sequence

>fig|553590.4.peg.96 Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28)/ endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
MAKKFNYKLPSMVALTLVGSAVTAHQVQAAETTQDQTTNKNVLDSNKVKATTEQAKAEVK
NPTQNISGTQVYQDPAIVQPKTANNKTGNAQVSQKVDTAQVNGDTRANQSATTNNTQPVA
KSTSTTAPKTNTNVTNAGYSLVDDEDDNSENQINPELIKSAAKPAALETQYKTAAPKAAT
TSAPKAKTEATPKVTTFSASAQPRSVAATPKTSLPKYKPQVNSSINDYIRKNNLKAPKIE
EDYTSYFPKYAYRNGVGRPEGIVVHDTANDRSTINGEISYMKNNYQNAFVHAFVDGDRII
ETAPTDYLSWGVGAVGNPRFINVEIVHTHDYASFARSMNNYADYAATQLQYYGLKPDSAE
YDGNGTVWTHYAVSKYLGGTDHADPHGYLRSHNYSYDQLYDLINEKYLIKMGKVAPWGTQ
STTTPTTPSKPTTPSKPSTGKLTVAANNGVAQIKPTNSGLYTTVYDKTGKATNEVQKTFA
VSKTATLGNQKFYLVQDYNSGNKFGWVKEGDVVYNTAKSPVNVNQSYSIKPGTKLYTVPW
GTSKQVAGSVSGSGNQTFKASKQQQIDKSIYLYGSVNGKSGWVSKAYLVDTAKPTPTPTP
KPSTPTTNNKLTVSSLNGVAQINAKNNGLFTTVYDKTGKPTKEVQKTFAVTKEASLGGNK
FYLVKDYNSPTLIGWVKQGDVIYNNAKSPVNVMQTYTVKPGTKLYSVPWGTYKQEAGAVS
GTGNQTFKATKQQQIDKSIYLFGTVNGKSGWVSKAYLAVPAAPKKAVAQPKTAVKAYTVT
KPQTTQTVSKIAQVKPNNTGIRASVYEKTAKNGAKYADRTFYVTKERAHGNETYVLLNNT
SHNIPLGWFNVKDLNVQNLGKEVKTTQKYTVNKSNNGLSMVPWGTKNQVILTGNNIAQGT
FNATKQVSVGKDVYLYGTINNRTGWVNAKDLTAPTAVKPTTSAAKDYNYTYVIKNGNGYY
YVTPNSDTAKYSLKAFNEQPFAVVKEQVINGQTWYYGKLSNGKLAWIKSTDLAKELIKYN
QTGMTLNQVAQIQAGLQYKPQVQRVPGKWTDANFNDVKHAMDTKRLAQDPALKYQFLRLD
QPQNISIDKINQFLKGKGVLENQGAAFNKAAQMYGINEVYLISHALLETGNGTSQLAKGA
DVVNNKVVTNSNTKYHNVFGIAAYDNDPLREGIKYAKQAGWDTVSKAIVGGAKFIGNSYV
KAGQNTLYKMRWNPAHPGTHQYATDVDWANINAKIIKGYYDKIGEVGKYFDIPQYK

MD5 = aa3ba13c819b0f2f50665d487e6d3c9e


  DNA Sequence

>fig|553590.4.peg.96 Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28)/ endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
atggcgaaaaaattcaattacaaactaccatcaatggttgcattaacgcttgtaggttca
gcagtcactgcacatcaagttcaagcagctgagacgacacaagatcaaactactaataaa
aacgttttagatagtaataaagttaaagcaactactgaacaagcaaaagctgaggtaaaa
aatccaacgcaaaacatttctggcactcaagtatatcaagaccctgctattgtccaacca
aaaacagcaaataacaaaacaggcaatgctcaagtaagtcaaaaagttgatactgcacaa
gtaaatggtgacactcgtgctaatcaatcagcgactacaaataatacgcagcctgttgca
aagtcaacaagcactacagcacctaaaactaacactaatgttacaaatgctggttatagt
ttagttgatgatgaagatgataattcagaaaatcaaattaatccagaattaattaaatca
gctgctaaacctgcagctcttgaaacgcaatataaaaccgcagcacctaaagctgcaact
acatcagcacctaaagctaaaactgaagcgacacctaaagtaactacttttagcgcttca
gcacaaccaagatcagttgctgcaacaccaaaaacgagtttgccaaaatataaaccacaa
gtaaactcttcaattaacgattacattcgtaaaaataacttaaaagcacctaaaattgaa
gaagattatacatcttacttccctaaatacgcataccgtaacggcgtaggtcgtcctgaa
ggtatcgtagttcatgatacagctaatgatcgttcgacgataaatggtgaaattagttat
atgaaaaataactatcaaaacgcattcgtacatgcatttgttgatggggatcgtataatc
gaaacagcaccaacggattacttatcttggggtgtcggtgcagtcggtaaccctagattc
atcaatgttgaaatcgtacacacacacgactatgcttcatttgcacgttcaatgaataac
tatgctgactatgcagctacacaattacaatattatggtttaaaaccagacagtgctgag
tatgatggaaatggtacagtatggactcactacgctgtaagtaaatatttaggtggtact
gaccatgccgatccacatggatatttaagaagtcataattatagttatgatcaattatat
gacttaattaatgaaaaatatttaataaaaatgggtaaagtggcgccatggggtacgcaa
tctacaactacccctactacaccatcaaaaccaacaacaccgtcgaaaccatcaactggt
aaattaacagttgctgcaaacaatggtgtcgcacaaatcaaaccaacaaatagtggttta
tatactactgtatacgacaaaactggtaaagcaactaatgaagttcaaaaaacatttgct
gtatctaaaacagctacattaggtaatcaaaaattctatcttgttcaagattacaattct
ggtaataaatttggttgggttaaagaaggcgatgtggtttacaacacagctaaatcacct
gtaaatgtaaatcaatcatattcaatcaaacctggtacgaaactttatacagtaccttgg
ggtacatctaaacaagttgctggtagtgtgtctggctctggaaaccaaacatttaaggct
tcaaagcaacaacaaattgataaatcaatttatttatatggctctgtgaatggtaaatct
ggttgggtaagtaaagcatatttagttgatactgctaaacctacgcctacaccaacacct
aagccatcaacacctacaacaaataataaattaacagtttcatcattaaacggtgttgct
caaattaatgctaaaaacaatggcttattcactacagtttatgacaaaactggtaagcca
acgaaagaagttcaaaaaacatttgctgtaacaaaagaagcaagtttaggtggaaacaaa
ttctacttagttaaagattacaatagtccaactttaattggttgggttaaacaaggtgac
gttatttataacaatgcaaaatcacctgtaaatgtaatgcaaacatatacagtaaaacca
ggcactaaattatattcagtaccttggggcacttataaacaagaagctggtgcagtttct
ggtacaggtaaccaaacttttaaagcgactaagcaacaacaaattgataaatctatctat
ttatttggaactgtaaatggtaaatctggttgggtaagtaaagcatatttagctgtacct
gctgcacctaaaaaagcagtagcacaaccaaaaacagctgtaaaagcttatactgttact
aaaccacaaacgactcaaacagttagcaagattgctcaagttaaaccaaacaacactggt
attcgtgcttctgtttatgaaaaaacagcgaaaaacggtgcgaaatatgcagaccgtacg
ttctatgtaacaaaagagcgtgctcatggtaatgaaacgtatgtattattaaacaataca
agccataacatcccattaggttggttcaatgtaaaagacttaaatgttcaaaacttaggc
aaagaagttaaaacgactcaaaaatatactgttaataaatcaaataacggcttatcaatg
gttccttggggtactaaaaaccaagtcattttaacaggcaataacattgctcaaggtaca
tttaatgcaacgaaacaagtatctgtaggcaaagatgtttatttatacggtactattaat
aaccgcactggttgggtaaatgcaaaagatttaactgcaccaaccgctgtgaaaccaact
acatcagctgccaaagattataactacacttatgtaattaaaaatggtaatggttattac
tatgtaacaccaaattctgatacagctaaatactcattaaaagcatttaatgaacaacca
ttcgcagttgttaaagaacaagtcattaatggacaaacttggtactatggtaaattatct
aacggtaaattagcatggattaaatcaactgatttagctaaagaattaattaagtataat
caaacaggtatgacattaaaccaagttgctcaaatacaagctggtttacaatataaacca
caagtacaacgtgtaccaggtaagtggacagatgctaactttaatgatgttaagcatgca
atggatacgaagcgtttagctcaagatccagcattaaaatatcaattcttacgcttagac
caaccacaaaatatttctattgataaaattaatcaattcttaaaaggtaaaggtgtatta
gaaaaccaaggtgctgcatttaacaaagctgctcaaatgtatggcattaatgaagtttat
cttatctcacatgccctattagaaacaggtaacggtacttctcaattagcgaaaggtgca
gatgtagtgaacaacaaagttgtaactaactcaaacacgaaataccataacgtatttggt
attgctgcatatgataacgatcctttacgtgaaggtattaaatatgctaaacaagctggt
tgggacacagtatcaaaagcaatcgttggtggtgctaaattcatcggcaactcatatgta
aaagctggtcaaaatacactttacaaaatgagatggaatcctgcacatccaggaacacac
caatatgctacagatgtagattgggctaacatcaatgctaaaatcatcaaaggctactat
gataaaattggcgaagtcggcaaatacttcgacatcccacaatataaataa


  DNA with Flanking Sequence

>fig|553590.4.peg.96 Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28)/ endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
actgctcgaatacgccctattaatgaaacaactgtcaaaatagaacgagtagctgtgatg
aaatcacatcgtggacaaggaatgggtagaatgcttatgcaagctgtagaatcattagct
aaagatgaaggtttttacgtagctactatgaatgcccaatgtcatgctatcccattttat
gaaagtttaaactttaaaatgagaggtaatatatttcttgaggaaggcatcgagcatatt
gaaatgacaaaaaagttaacctcgcttaattaaaaaaagttgtatctattttagaaacat
ttgtaataaaccaattcttaaattgacatcaattctatttgatttgtcacgtcaccattg
agattcaaaatttttttcatttttttacagtgaaaatgtaaattaagagtatattacaaa
ttggttaaatacgcacaggtatataaaacaggtactataatgttagtaataattaataaa
tgttaggagtaataaatagaatggcgaaaaaattcaattacaaactaccatcaatggttg
cattaacgcttgtaggttcagcagtcactgcacatcaagttcaagcagctgagacgacac
aagatcaaactactaataaaaacgttttagatagtaataaagttaaagcaactactgaac
aagcaaaagctgaggtaaaaaatccaacgcaaaacatttctggcactcaagtatatcaag
accctgctattgtccaaccaaaaacagcaaataacaaaacaggcaatgctcaagtaagtc
aaaaagttgatactgcacaagtaaatggtgacactcgtgctaatcaatcagcgactacaa
ataatacgcagcctgttgcaaagtcaacaagcactacagcacctaaaactaacactaatg
ttacaaatgctggttatagtttagttgatgatgaagatgataattcagaaaatcaaatta
atccagaattaattaaatcagctgctaaacctgcagctcttgaaacgcaatataaaaccg
cagcacctaaagctgcaactacatcagcacctaaagctaaaactgaagcgacacctaaag
taactacttttagcgcttcagcacaaccaagatcagttgctgcaacaccaaaaacgagtt
tgccaaaatataaaccacaagtaaactcttcaattaacgattacattcgtaaaaataact
taaaagcacctaaaattgaagaagattatacatcttacttccctaaatacgcataccgta
acggcgtaggtcgtcctgaaggtatcgtagttcatgatacagctaatgatcgttcgacga
taaatggtgaaattagttatatgaaaaataactatcaaaacgcattcgtacatgcatttg
ttgatggggatcgtataatcgaaacagcaccaacggattacttatcttggggtgtcggtg
cagtcggtaaccctagattcatcaatgttgaaatcgtacacacacacgactatgcttcat
ttgcacgttcaatgaataactatgctgactatgcagctacacaattacaatattatggtt
taaaaccagacagtgctgagtatgatggaaatggtacagtatggactcactacgctgtaa
gtaaatatttaggtggtactgaccatgccgatccacatggatatttaagaagtcataatt
atagttatgatcaattatatgacttaattaatgaaaaatatttaataaaaatgggtaaag
tggcgccatggggtacgcaatctacaactacccctactacaccatcaaaaccaacaacac
cgtcgaaaccatcaactggtaaattaacagttgctgcaaacaatggtgtcgcacaaatca
aaccaacaaatagtggtttatatactactgtatacgacaaaactggtaaagcaactaatg
aagttcaaaaaacatttgctgtatctaaaacagctacattaggtaatcaaaaattctatc
ttgttcaagattacaattctggtaataaatttggttgggttaaagaaggcgatgtggttt
acaacacagctaaatcacctgtaaatgtaaatcaatcatattcaatcaaacctggtacga
aactttatacagtaccttggggtacatctaaacaagttgctggtagtgtgtctggctctg
gaaaccaaacatttaaggcttcaaagcaacaacaaattgataaatcaatttatttatatg
gctctgtgaatggtaaatctggttgggtaagtaaagcatatttagttgatactgctaaac
ctacgcctacaccaacacctaagccatcaacacctacaacaaataataaattaacagttt
catcattaaacggtgttgctcaaattaatgctaaaaacaatggcttattcactacagttt
atgacaaaactggtaagccaacgaaagaagttcaaaaaacatttgctgtaacaaaagaag
caagtttaggtggaaacaaattctacttagttaaagattacaatagtccaactttaattg
gttgggttaaacaaggtgacgttatttataacaatgcaaaatcacctgtaaatgtaatgc
aaacatatacagtaaaaccaggcactaaattatattcagtaccttggggcacttataaac
aagaagctggtgcagtttctggtacaggtaaccaaacttttaaagcgactaagcaacaac
aaattgataaatctatctatttatttggaactgtaaatggtaaatctggttgggtaagta
aagcatatttagctgtacctgctgcacctaaaaaagcagtagcacaaccaaaaacagctg
taaaagcttatactgttactaaaccacaaacgactcaaacagttagcaagattgctcaag
ttaaaccaaacaacactggtattcgtgcttctgtttatgaaaaaacagcgaaaaacggtg
cgaaatatgcagaccgtacgttctatgtaacaaaagagcgtgctcatggtaatgaaacgt
atgtattattaaacaatacaagccataacatcccattaggttggttcaatgtaaaagact
taaatgttcaaaacttaggcaaagaagttaaaacgactcaaaaatatactgttaataaat
caaataacggcttatcaatggttccttggggtactaaaaaccaagtcattttaacaggca
ataacattgctcaaggtacatttaatgcaacgaaacaagtatctgtaggcaaagatgttt
atttatacggtactattaataaccgcactggttgggtaaatgcaaaagatttaactgcac
caaccgctgtgaaaccaactacatcagctgccaaagattataactacacttatgtaatta
aaaatggtaatggttattactatgtaacaccaaattctgatacagctaaatactcattaa
aagcatttaatgaacaaccattcgcagttgttaaagaacaagtcattaatggacaaactt
ggtactatggtaaattatctaacggtaaattagcatggattaaatcaactgatttagcta
aagaattaattaagtataatcaaacaggtatgacattaaaccaagttgctcaaatacaag
ctggtttacaatataaaccacaagtacaacgtgtaccaggtaagtggacagatgctaact
ttaatgatgttaagcatgcaatggatacgaagcgtttagctcaagatccagcattaaaat
atcaattcttacgcttagaccaaccacaaaatatttctattgataaaattaatcaattct
taaaaggtaaaggtgtattagaaaaccaaggtgctgcatttaacaaagctgctcaaatgt
atggcattaatgaagtttatcttatctcacatgccctattagaaacaggtaacggtactt
ctcaattagcgaaaggtgcagatgtagtgaacaacaaagttgtaactaactcaaacacga
aataccataacgtatttggtattgctgcatatgataacgatcctttacgtgaaggtatta
aatatgctaaacaagctggttgggacacagtatcaaaagcaatcgttggtggtgctaaat
tcatcggcaactcatatgtaaaagctggtcaaaatacactttacaaaatgagatggaatc
ctgcacatccaggaacacaccaatatgctacagatgtagattgggctaacatcaatgcta
aaatcatcaaaggctactatgataaaattggcgaagtcggcaaatacttcgacatcccac
aatataaataagcaacatgaacataggatcaaaagtcatcccccactatcaatcatgggg
gatgacctttgatcccttttttatacatacacaagcaaaaatagcggtgattgtttacca
tcaattttaacaatcaccgctacttttgcttgtaattcatgattcaatttttgttgtgtg
cacaacgacactaaattatgtgtttgctattgtcgtgttacaacgatatgcgtcgttgat
ttaacttatcaagtaattgatttaaattgtctaattcgacttccgataaacattgacatc
ttgcttcaatcaattcgcaacgtgcattatttatttgtgaaattaatgtacgtgcttgat
cagtcaaaattaattctttacatcttaaatcttcgctagattgttgacttgtgatgtacc
ctttcaaaactaatttcttaatccaccttgaaactatagattgttccctgctaatcttca
tcgtcaaatcatactgtgataagcgatcgta


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0004040       F:amidase activity
GO:0008745       F:N-acetylmuramoyl-L-alanine amidase activity
GO:0009253       P:peptidoglycan catabolic process
GO:0010382       P:cellular cell wall macromolecule metabolic ...
GO:0033925       F:mannosyl-glycoprotein endo-beta-N-acetylglu...
cmr|SAUSA300_0955 Staphylococcus aureus subsp. aureus USA300-FPR3757     autolysin
fig|367830.3.peg.1520 Staphylococcus aureus subsp. aureus USA300 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28)/ endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|451515.3.peg.1048 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28)/ endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|451516.9.peg.1052 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28)/ endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|452948.4.peg.2064 Staphylococcus aureus 930918-3 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28)/ endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|455227.3.peg.1413 Staphylococcus aureus D30 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28)/ endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|553567.3.peg.1496 Staphylococcus aureus A5948 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28)/ endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
fig|553594.3.peg.2035 Staphylococcus aureus A9765 FIG   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28)/ endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)
gb|ABD22514.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     autolysin
gb|ABX29017.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     bifunctional N-acetylmuramoyl-L-alanine amidase/mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
gb|EEV83045.1 Staphylococcus aureus A5948     bifunctional autolysin
gi|160368046 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   bifunctional N-acetylmuramoyl-L-alanine amidase/mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
gi|161509237 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   bifunctional N-acetylmuramoyl-L-alanine amidase/mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
gi|257860213 Staphylococcus aureus A5948 NCBI   bifunctional autolysin
gi|258451998 Staphylococcus aureus A5948 NCBI   bifunctional autolysin
gi|87128000 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   autolysin
gi|87162026 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   autolysin
img|637887607 Staphylococcus aureus aureus USA300 IMG   autolysin( EC:3.5.1.28 )
img|641308967 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   bifunctional N-acetylmuramoyl-L-alanine amidase/mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase( EC:3.2.1.96,EC:3.5.1.28 )
img|641772576 Staphylococcus aureus aureus USA300_TCH959 IMG   autolysin
kegg|saa:SAUSA300_0955 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   autolysin (EC:3.5.1.28)
kegg|sax:USA300HOU_0997 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   bifunctional N-acetylmuramoyl-L-alanine amidase/mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase (EC:3.5.1.28 3.2.1.96)
ref|YP_001574896.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   bifunctional N-acetylmuramoyl-L-alanine amidase/mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
ref|YP_493653.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   autolysin
ref|ZP_05700014.1 Staphylococcus aureus A5948 RefSeq   bifunctional autolysin
tr|A8Z0E3 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Bifunctional N-acetylmuramoyl-L-alanine amidase/mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
tr|Q2FI25 Staphylococcus aureus (strain USA300) TrEMBL   Autolysin


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search