The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|553590.4.peg.95: Staphylococcus aureus A9754

This feature in The SEED Viewer

NCBI Taxonomy Id: 553590

Current Assignment: Putative ATL autolysin transcription regulator
Translate Function Assignments



Context on contig NZ_ADJI01000001 from base 97634 to 108631 (10998 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
91 98815 97634 1182 -           Staphopain B precursor (EC 3.4.22.-) locus|SKAG_00091, protein_id|ZP_06788781.1, gi|294848034
92 99907 98897 1011 - 81     1: 5 dlit(96922)
dlit(3306605)
Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA locus|SKAG_00092, protein_id|ZP_06788782.1, gi|294848035
93 101589 100435 1155 - 527     2: 3 6   N-acetyl-L,L-diaminopimelate aminotransferase (EC 2.6.1.-) locus|SKAG_00093, protein_id|ZP_06788783.1, gi|294848036
94 102795 101785 1011 - 195         membrane protein, putative locus|SKAG_00094, protein_id|ZP_06788784.1, gi|294848037
95 102948 103367 420 + 152         Putative ATL autolysin transcription regulator locus|SKAG_00095, protein_id|ZP_06788785.1, gi|294848038
96 107344 103574 3771 - 206     3: 4 2 1   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28)/ endo-beta-N-acetylglucosaminidase (EC 3.2.1.96) locus|SKAG_00097, protein_id|ZP_06788787.1, gi|294848040
97 108006 107572 435 - 227         GNAT family acetyltransferase YjcF locus|SKAG_00098, protein_id|ZP_06788788.1, gi|294848041
98 108631 108161 471 - 154         FIG01108206: hypothetical protein locus|SKAG_00099, protein_id|ZP_06788789.1, gi|294848042

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|553590.4.peg.95 Putative ATL autolysin transcription regulator
MYKQLEKLITLTNNDLNLVNRRFGQRTDIKSEQLELLRILFNYDRLSQYDLTMKISREQS
IVSRWIKKLVLKGYITSQQSSEDLRCKELILTDQARTLISQINNARCELIEARCQCLSEV
ELDNLNQLLDKLNQRRISL

MD5 = 56783dfc6b635676ac5d84cd89954e87


  DNA Sequence

>fig|553590.4.peg.95 Putative ATL autolysin transcription regulator
atgtataaacaacttgaaaaacttattacactgactaacaatgacttaaacttagtgaat
agaagatttggacaacgcacggatatcaaatctgaacagctagaacttctccgtatttta
tttaattacgatcgcttatcacagtatgatttgacgatgaagattagcagggaacaatct
atagtttcaaggtggattaagaaattagttttgaaagggtacatcacaagtcaacaatct
agcgaagatttaagatgtaaagaattaattttgactgatcaagcacgtacattaatttca
caaataaataatgcacgttgcgaattgattgaagcaagatgtcaatgtttatcggaagtc
gaattagacaatttaaatcaattacttgataagttaaatcaacgacgcatatcgttgtaa


  DNA with Flanking Sequence

>fig|553590.4.peg.95 Putative ATL autolysin transcription regulator
gatcaaaaaccataacgcaaatactgggttaaaaggatcaagttgtaattcgtcactttt
acctgttaagaaataataaattgaaaagaatgcaaaaaatatcatataaggtactatcaa
acgttttgaaattttttctaaatagtatggtttatcaatatttttcgcgaaataaccaga
tataaacaaaaatgttggcatatggaaactataaataactaggtataatgctgataaata
tttatcgccactagtgtagggttgtaacatatgtccaaatacgactaataatattaaaat
tgctcttgcgttgtcaaaaaaataatctctctcttttaatgaagtcatattttatctcct
ttatgtccataagactcttactaatttattatattttgtattagttatgcaacaaatttg
tctattgtgtcgaatagtattgtaaaaattataaaaaaagcatataatattataaataat
atgtagtggagtagaacaacatgtataaacaacttgaaaaacttattacactgactaaca
atgacttaaacttagtgaatagaagatttggacaacgcacggatatcaaatctgaacagc
tagaacttctccgtattttatttaattacgatcgcttatcacagtatgatttgacgatga
agattagcagggaacaatctatagtttcaaggtggattaagaaattagttttgaaagggt
acatcacaagtcaacaatctagcgaagatttaagatgtaaagaattaattttgactgatc
aagcacgtacattaatttcacaaataaataatgcacgttgcgaattgattgaagcaagat
gtcaatgtttatcggaagtcgaattagacaatttaaatcaattacttgataagttaaatc
aacgacgcatatcgttgtaacacgacaatagcaaacacataatttagtgtcgttgtgcac
acaacaaaaattgaatcatgaattacaagcaaaagtagcggtgattgttaaaattgatgg
taaacaatcaccgctatttttgcttgtgtatgtataaaaaagggatcaaaggtcatcccc
catgattgatagtgggggatgacttttgatcctatgttcatgttgcttatttatattgtg
ggatgtcgaagtatttgccgacttcgccaattttatcatagtagcctttgatgattttag
cattgatgttagcccaatctacatctgtagcatattggtgtgttcctggatgtgcaggat
tccatctcattttgtaaagtgtattttgaccagcttttacatatgagttgccgatgaatt
tagcaccaccaacgattgcttttgatactgtgtcccaaccagcttgtttagcatatttaa
taccttcacgtaaaggatcgttatcatatgcagcaatacc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003700       F:transcription factor activity
GO:0005622       C:intracellular
GO:0006350       P:transcription
GO:0006355       P:regulation of transcription, DNA-dependent
cmr|SAUSA300_0954 Staphylococcus aureus subsp. aureus USA300-FPR3757     transcriptional regulator, MarR family
fig|367830.3.peg.1519 Staphylococcus aureus subsp. aureus USA300 FIG   Putative ATL autolysin transcription regulator
fig|451515.3.peg.1047 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Putative ATL autolysin transcription regulator
fig|451516.9.peg.1051 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Putative ATL autolysin transcription regulator
fig|452948.4.peg.2063 Staphylococcus aureus 930918-3 FIG   Putative ATL autolysin transcription regulator
fig|455227.3.peg.1412 Staphylococcus aureus D30 FIG   Putative ATL autolysin transcription regulator
fig|546342.3.peg.1021 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Putative ATL autolysin transcription regulator
fig|546343.3.peg.1888 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Putative ATL autolysin transcription regulator
fig|553567.3.peg.1498 Staphylococcus aureus A5948 FIG   Putative ATL autolysin transcription regulator
fig|553594.3.peg.2034 Staphylococcus aureus A9765 FIG   Putative ATL autolysin transcription regulator
fig|644279.4.peg.1056 Staphylococcus aureus subsp. aureus 132 FIG   Putative ATL autolysin transcription regulator
gb|ABD22816.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     transcriptional regulator, MarR family
gb|EEV83046.1 Staphylococcus aureus A5948     ATL autolysin transcription regulator
gb|EEW44329.1 Staphylococcus aureus 930918-3     hypothetical protein, probable ATL autolysin transcription regulator
gb|EEW47069.1 Staphylococcus aureus D30     hypothetical protein, probable ATL autolysin transcription regulator
gi|221138029 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   MarR family transcriptional regulator
gi|221141835 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   MarR family transcriptional regulator
gi|257860214 Staphylococcus aureus A5948 NCBI   ATL autolysin transcription regulator
gi|258451999 Staphylococcus aureus A5948 NCBI   ATL autolysin transcription regulator
gi|259159271 Staphylococcus aureus 930918-3 NCBI   hypothetical protein, probable ATL autolysin transcription regulator
gi|259162500 Staphylococcus aureus D30 NCBI   hypothetical protein, probable ATL autolysin transcription regulator
gi|87128302 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   transcriptional regulator, MarR family
gi|87162328 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   MarR family transcriptional regulator
img|637887606 Staphylococcus aureus aureus USA300 IMG   transcriptional regulator, MarR family
img|641772574 Staphylococcus aureus aureus USA300_TCH959 IMG   transcriptional regulator, MarR family protein
kegg|saa:SAUSA300_0954 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   MarR family transcriptional regulator
ref|YP_493652.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   MarR family transcriptional regulator
ref|ZP_03562831.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   MarR family transcriptional regulator
ref|ZP_03566328.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   MarR family transcriptional regulator
ref|ZP_05700015.1 Staphylococcus aureus A5948 RefSeq   ATL autolysin transcription regulator
tr|Q2FI26 Staphylococcus aureus (strain USA300) TrEMBL   Transcriptional regulator, MarR family


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


Tool Description
General Tools
Psi-Blast NCBI's psi-blast is used to locate distant similarities
Transmembrane Predictions
TMpred Tool for Predicting Transmembrane regions
TMHMM Prediction of transmembrane helices in proteins
Protein Signals for Gram negative bacteria
Gram negative PSORT Prediction of protein localization sites
Gram negative SignalP Predicts the presence and location of signal peptide cleavage sites
Protein Signals for Gram positive bacteria
Gram positive PSORT Prediction of protein localization sites
Gram positive SignalP Predicts the presence and location of signal peptide cleavage sites
Other useful tools
LipoP Prediction of lipoproteins and signal peptides in Gram negative bacteria
Radar Rapid Automatic Detection and Alignment of Repeats in protein sequences
PPSearch Search for protein motifs against all patterns stored in the PROSITE pattern database
Gram negative CELLO Subcellular localization predictor at National Chiao Tung University
Gram positive CELLO Subcellular localization predictor at National Chiao Tung University
ProDom A comprehensive set of protein domain families automatically generated from the SWISS-PROT and TrEMBL sequence databases
PDB An Information Portal to Biological Macromolecular Structures
For Specific Organisms
RNAFold The RNAfold web server will predict secondary structures of single stranded RNA or DNA sequences.

< Hide tool descriptions


FIG search