The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|553590.4.peg.88: Staphylococcus aureus A9754

This feature in The SEED Viewer

NCBI Taxonomy Id: 553590

Current Assignment: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (EC 4.2.99.20)
Translate Function Assignments



Context on contig NZ_ADJI01000001 from base 90300 to 101589 (11290 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
83 90515 90300 216 -           FIG01108199: hypothetical protein locus|SKAG_00083, protein_id|ZP_06788773.1, gi|294848026
84 90680 91231 552 + 164         Acetyltransferase (GNAT family) SAS0976 locus|SKAG_00084, protein_id|ZP_06788774.1, gi|294848027
85 92221 91283 939 - 51 4 2: 2 1   1,4-dihydroxy-2-naphthoate polyprenyltransferase (EC 2.5.1.74) locus|SKAG_00085, protein_id|ZP_06788775.1, gi|294848028
86 92553 93764 1212 + 331 13 2: 2 1   Isochorismate synthase (EC 5.4.4.2) @ Menaquinone-specific isochorismate synthase (EC 5.4.4.2) locus|SKAG_00086, protein_id|ZP_06788776.1, gi|294848029
87 93751 95424 1674 + -14 19 2: 2 1   2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (EC 2.2.1.9) locus|SKAG_00087, protein_id|ZP_06788777.1, gi|294848030
88 95411 96214 804 + -14   2: 2 1   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (EC 4.2.99.20) locus|SKAG_00088, protein_id|ZP_06788778.1, gi|294848031
89 96207 97028 822 + -8 6 2: 2 1 dlit(20643650) Naphthoate synthase (EC 4.1.3.36) locus|SKAG_00089, protein_id|ZP_06788779.1, gi|294848032
90 97596 97267 330 - 238         Staphostatin B locus|SKAG_00090, protein_id|ZP_06788780.1, gi|294848033
91 98815 97634 1182 - 37         Staphopain B precursor (EC 3.4.22.-) locus|SKAG_00091, protein_id|ZP_06788781.1, gi|294848034
92 99907 98897 1011 - 81     1: 4 dlit(96922)
dlit(3306605)
Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA locus|SKAG_00092, protein_id|ZP_06788782.1, gi|294848035
93 101589 100435 1155 - 527     2: 3 5   N-acetyl-L,L-diaminopimelate aminotransferase (EC 2.6.1.-) locus|SKAG_00093, protein_id|ZP_06788783.1, gi|294848036

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Menaquinone_and_Phylloquinone_Biosynthesis OlgaZ 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (EC 4.2.99.20)
Menaquinone_biosynthesis_PanGenomes Smajic_Semra_user 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (EC 4.2.99.20)


  Protein Sequence

>fig|553590.4.peg.88 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (EC 4.2.99.20)
MTHYKFYEANVETNQVLVFLHGFLSDSRTYHNHIEKFTDNYHVITIDLPGHGEDQSSMDE
TWNFDYITTLLDRILDKYKDKSITLFGYSMGGRVALYYAINGHIPISNLILESTSPGIKE
EANQLERRLVDDARAKVLDIAGIELFVNDWEKLPLFQSQLELPVEIQHQIRQQRLSQSPH
KMAKALRDYGTGQMPNLWPRLKEIKAPTLILAGEYDEKFVQIAKKMANLIPNSKCKLISA
TGHTIHVEDSDEFDTMILGFLKEEQND

MD5 = 4cb7cfbe1080932bb48e11f44181b5aa


  DNA Sequence

>fig|553590.4.peg.88 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (EC 4.2.99.20)
atgacacattataaattttatgaagcaaacgttgagaccaatcaagttttagtatttctg
catggatttcttagcgacagccgtacttatcataatcacatcgaaaaatttactgataac
tatcatgtcatcactatagacttaccaggccatggcgaagatcagtcttcaatggatgaa
acgtggaattttgattatattacgacgttgttagaccgaattttagataaatataaagat
aaatcaataacattgtttggatattcaatgggtgggcgtgttgcattatattatgcaatt
aatggtcacatccctatatctaatttgatattagaaagtacgtcaccaggtattaaagaa
gaagcaaatcaattggaacgccgtcttgttgatgatgcacgtgctaaagtattagacata
gcaggtattgaattatttgttaatgattgggaaaagttgccattatttcaatcgcaacta
gaattaccagttgaaatacaacatcaaataagacaacaacgattgtctcaatcgccacat
aaaatggccaaagcattaagagattatggtacaggtcaaatgccaaacttatggccgcgc
ctgaaagaaattaaagcaccaacattaatattagctggagaatatgatgaaaaatttgta
cagattgcgaaaaaaatggcaaatttaattcctaatagtaaatgtaaattaatttctgct
acaggtcatacaattcatgtggaagatagtgatgaatttgatacaatgatattaggattt
ttaaaggaggagcaaaatgactaa


  DNA with Flanking Sequence

>fig|553590.4.peg.88 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (EC 4.2.99.20)
tagtaatagtatgcctatcagagatgtagataacttgttattgaataaaaatatagatgt
ctatgcgaatcgtggtgcgaatggtattgatggtatcgtttcaactgcactgggtatggc
tgtgcataaacgaataacattattgataggtgatttatcattttatcatgatatgaatgg
actattaatgtcaaaattaaataatattcagatgaatattgtattattgaacaacgatgg
tggcggtattttttcatatttaccacaaaaagaaagtgcaactgactattttgaacggtt
gtttggcacaccgacgggattggatttcgagtatacagctaagttatatcaattcgattt
taaacgttttaacagtgtttcagaatttaaaaatgccacattgttatctgaaacttcgac
gatttatgaattgataacgaatcgcgaagataactttaaacagcatcaaattttatacca
gaaattgagtgaaatgattcatgacacattataaattttatgaagcaaacgttgagacca
atcaagttttagtatttctgcatggatttcttagcgacagccgtacttatcataatcaca
tcgaaaaatttactgataactatcatgtcatcactatagacttaccaggccatggcgaag
atcagtcttcaatggatgaaacgtggaattttgattatattacgacgttgttagaccgaa
ttttagataaatataaagataaatcaataacattgtttggatattcaatgggtgggcgtg
ttgcattatattatgcaattaatggtcacatccctatatctaatttgatattagaaagta
cgtcaccaggtattaaagaagaagcaaatcaattggaacgccgtcttgttgatgatgcac
gtgctaaagtattagacatagcaggtattgaattatttgttaatgattgggaaaagttgc
cattatttcaatcgcaactagaattaccagttgaaatacaacatcaaataagacaacaac
gattgtctcaatcgccacataaaatggccaaagcattaagagattatggtacaggtcaaa
tgccaaacttatggccgcgcctgaaagaaattaaagcaccaacattaatattagctggag
aatatgatgaaaaatttgtacagattgcgaaaaaaatggcaaatttaattcctaatagta
aatgtaaattaatttctgctacaggtcatacaattcatgtggaagatagtgatgaatttg
atacaatgatattaggatttttaaaggaggagcaaaatgactaacagacaatgggaaaca
cttagagaatatgatgaaatcaaatatgaattttacgaagggattgctaaggtaacaata
aatcgccctgaagtacgcaatgcgtttacacctaaaacagttgctgaaatgattgacgca
ttttcacgtgcacgtgatgatcaaaacgtttcagttatcgtattaactggtgaaggtgat
ttagcattctgttctggtggtgaccagaagaaacgtggacatggtggttatgtaggtgaa
gaccaaatccctcgcttaaatgtattagatttacagcgtttaattcgtattattccaaaa
ccggttatcgcgatggtaaaaggttatgctgtaggtggcggtaatgtactaaatgttgtt
tgtgacttaacgattgctgctgataatgctatttttggacaaactggtcctaaagtaggt
tcatttgatgcgggttatggttcaggatatttagcacgtatcgttggacataagaaagca
cgtg


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|553590.4.peg.85 1,4-dihydroxy-2-naphthoate polyprenyltransferase (EC 2.5.1.74)
13 fig|553590.4.peg.86 Isochorismate synthase (EC 5.4.4.2) @ Menaquinone-specific isochorismate synthase (EC 5.4.4.2)
19 fig|553590.4.peg.87 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (EC 2.2.1.9)
6 fig|553590.4.peg.89 Naphthoate synthase (EC 4.1.3.36)


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search