The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
 The SEED


FIG search

Protein fig|553590.4.peg.82: Staphylococcus aureus A9754

This feature in The SEED Viewer

NCBI Taxonomy Id: 553590

Current Assignment: FIG01108070: hypothetical protein
Translate Function Assignments


Context on contig NZ_ADJI01000001 from base 84789 to 95424 (10636 bp)

Fid Start End Size
(nt)		   Gap Find
best
clusters		 Pins Fc-sc SS Ev Function Aliases
75 84789 85109 321 +           FIG01108238: hypothetical protein locus|SKAG_00075, protein_id|ZP_06788765.1, gi|294848018
76 85106 85747 642 + -4     4: 10 6 9 7   Methionine ABC transporter ATP-binding protein locus|SKAG_00076, protein_id|ZP_06788766.1, gi|294848019
77 86023 85835 189 - 87         FIG01107942: hypothetical protein locus|SKAG_00077, protein_id|ZP_06788767.1, gi|294848020
78 86404 86691 288 + 380         FIG01108706: hypothetical protein locus|SKAG_00078, protein_id|ZP_06788768.1, gi|294848021
79 86697 88178 1482 + 5     2: 5 3   Poly(glycerol-phosphate) alpha-glucosyltransferase (EC 2.4.1.52) locus|SKAG_00079, protein_id|ZP_06788769.1, gi|294848022
80 88626 88267 360 - 88         FIG01107947: hypothetical protein locus|SKAG_00080, protein_id|ZP_06788770.1, gi|294848023
81 89100 90059 960 + 473     3: 3 8 4   Heme ABC type transporter HtsABC, heme-binding protein locus|SKAG_00081, protein_id|ZP_06788771.1, gi|294848024
82 90221 90105 117 - 45         FIG01108070: hypothetical protein locus|SKAG_00082, protein_id|ZP_06788772.1, gi|294848025
83 90515 90300 216 - 78         FIG01108199: hypothetical protein locus|SKAG_00083, protein_id|ZP_06788773.1, gi|294848026
84 90680 91231 552 + 164         Acetyltransferase (GNAT family) SAS0976 locus|SKAG_00084, protein_id|ZP_06788774.1, gi|294848027
85 92221 91283 939 - 51     2: 2 1   1,4-dihydroxy-2-naphthoate polyprenyltransferase (EC 2.5.1.74) locus|SKAG_00085, protein_id|ZP_06788775.1, gi|294848028
86 92553 93764 1212 + 331     2: 2 1   Isochorismate synthase (EC 5.4.4.2) @ Menaquinone-specific isochorismate synthase (EC 5.4.4.2) locus|SKAG_00086, protein_id|ZP_06788776.1, gi|294848029
87 93751 95424 1674 + -14     2: 2 1   2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (EC 2.2.1.9) locus|SKAG_00087, protein_id|ZP_06788777.1, gi|294848030

Annotation History   /   View All Related Annotations Help on Annotations


  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|553590.4.peg.82 FIG01108070: hypothetical protein
MRQFIKRTVKTILVGYVIKFIRNKLSGKSSHPTDNKHN

MD5 = a66e3cf1c025a749e8ed965595dc26ed


  DNA Sequence

>fig|553590.4.peg.82 FIG01108070: hypothetical protein
atgcgccaattcattaaaagaactgttaaaacaatccttgtcggttatgtaattaaattt
attcgaaataaactttcaggtaaatcatcacatccgacagataataaacataattaa


  DNA with Flanking Sequence

>fig|553590.4.peg.82 FIG01108070: hypothetical protein
cgcaatatcaaatcggtcctctggacgtgcttgacgtatcactatgtcatcattcccttt
tacgttattaacatttattatatagaaattctagcttattttaaaaagatatacttataa
ttttagaaagtttgaaaattctaaagttagaaatattggttttcacaacgaatttaagta
gaattatagttaaggaggatttacaaatgaaagtcaataaagccatttatgttattgttg
cattatttcttggaggtttaggtattcataaattttatgctgataaatttggacaaggtc
tttttcacttattatttttctggacaggtatccctaccatcatctcaataatacatgcaa
tttttgtcatttttactaaaaaagcagataaagatggttatattatattccctaaaaatt
aaattgtgacaatgacgtttaaaaagcatatatgaatgggtatatagttcgtaagatata
gagaaatgaggtatgtaacgatgcgccaattcattaaaagaactgttaaaacaatccttg
tcggttatgtaattaaatttattcgaaataaactttcaggtaaatcatcacatccgacag
ataataaacataattaaaaatacagcgccactcttatatgatttacgagtagcgctgtat
ttttattttgctttttctgcaattttttctaaatcttctgccatactttcacttgcgata
atcccccttgatttcaaccacttatttcggtcaacgtcataaactttgttatctttcaca
gcttttaatgatttccaaactgcaggatcaatgaatttcgttctatttttgtccgttttt
ccgtcagtggctaaaatcataacttttggattgatattggcaagttcttcattatttaaa
tatatataaggaccacccttgcgttcaccaacatgcgtagttttgtcttttgtgacttca
ggttgaatacccattttaattaagaattgtcccataaatgtatcttcattattaataaac
atacctgctcttgagataccgaatgcaaatgcagattttaacgtactctgttcaattttc
tttctaatctccgctaatattttatcatgcttttcca


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT05SA0886 Staphylococcus aureus NCTC 8325     conserved hypothetical protein
fig|158878.14.peg.1065 Staphylococcus aureus subsp. aureus Mu50 FIG   FIG01108070: hypothetical protein
fig|158879.11.peg.953 Staphylococcus aureus subsp. aureus N315 FIG   FIG01108070: hypothetical protein
fig|359786.13.peg.1170 Staphylococcus aureus subsp. aureus JH9 FIG   FIG01108070: hypothetical protein
fig|359787.11.peg.1151 Staphylococcus aureus subsp. aureus JH1 FIG   FIG01108070: hypothetical protein
fig|418127.6.peg.1048 Staphylococcus aureus subsp. aureus Mu3 FIG   FIG01108070: hypothetical protein
fig|426430.8.peg.982 Staphylococcus aureus subsp. aureus str. Newman FIG   FIG01108070: hypothetical protein
fig|451515.3.peg.1034 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   FIG01108070: hypothetical protein
fig|451516.9.peg.1038 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   FIG01108070: hypothetical protein
fig|452948.4.peg.2050 Staphylococcus aureus 930918-3 FIG   FIG01108070: hypothetical protein
fig|455227.3.peg.1398 Staphylococcus aureus D30 FIG   FIG01108070: hypothetical protein
fig|505321.3.peg.1724 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   FIG01108070: hypothetical protein
fig|546342.3.peg.1008 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   FIG01108070: hypothetical protein
fig|546343.3.peg.1875 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   FIG01108070: hypothetical protein
fig|553565.3.peg.1766 Staphylococcus aureus A5937 FIG   FIG01108070: hypothetical protein
fig|553567.3.peg.1511 Staphylococcus aureus A5948 FIG   FIG01108070: hypothetical protein
fig|553568.3.peg.2252 Staphylococcus aureus A6224 FIG   FIG01108070: hypothetical protein
fig|553571.3.peg.1982 Staphylococcus aureus A6300 FIG   FIG01108070: hypothetical protein
fig|553573.3.peg.214 Staphylococcus aureus A8115 FIG   FIG01108070: hypothetical protein
fig|553577.3.peg.1505 Staphylococcus aureus A8796 FIG   FIG01108070: hypothetical protein
fig|553580.3.peg.985 Staphylococcus aureus A8819 FIG   FIG01108070: hypothetical protein
fig|553581.3.peg.1022 Staphylococcus aureus A9299 FIG   FIG01108070: hypothetical protein
fig|553588.3.peg.2179 Staphylococcus aureus A9719 FIG   FIG01108070: hypothetical protein
fig|553592.3.peg.2 Staphylococcus aureus A9763 FIG   FIG01108070: hypothetical protein
fig|553594.3.peg.1685 Staphylococcus aureus A9765 FIG   FIG01108070: hypothetical protein
fig|553596.3.peg.2152 Staphylococcus aureus A9781 FIG   FIG01108070: hypothetical protein
fig|553601.3.peg.889 Staphylococcus aureus A10102 FIG   FIG01108070: hypothetical protein
fig|585891.3.peg.1062 Staphylococcus aureus subsp. aureus Mu50-omega FIG   FIG01108070: hypothetical protein
fig|644279.4.peg.1043 Staphylococcus aureus subsp. aureus 132 FIG   FIG01108070: hypothetical protein
fig|680649.3.peg.2199 Staphylococcus aureus subsp. aureus MR1 FIG   FIG01108070: hypothetical protein
fig|681288.4.peg.1006 Staphylococcus aureus subsp. aureus ED98 FIG   FIG01108070: hypothetical protein
fig|703339.3.peg.1007 Staphylococcus aureus 04-02981 FIG   FIG01108070: hypothetical protein
fig|93061.5.peg.898 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FIG01108070: hypothetical protein
fig|93062.19.peg.1018 Staphylococcus aureus subsp. aureus COL FIG   FIG01108070: hypothetical protein
gb|EEV65858.1 Staphylococcus aureus A9763     conserved hypothetical protein
gi|221138016 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_05088
gi|221141822 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_09356
gi|253316197 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   hypothetical protein SauraC_08662
gi|255005826 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_05135
gi|257841417 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|258406878 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
img|641772561 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical protein
ref|ZP_03562818.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_05088
ref|ZP_03566315.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_09356
ref|ZP_04839410.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   hypothetical protein SauraC_08662
ref|ZP_05144427.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_05135
ref|ZP_05680031.1 Staphylococcus aureus A9763 RefSeq   conserved hypothetical protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link

  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key		 Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer

Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options

|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions
FIG search