The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|546342.3.peg.1520: Staphylococcus aureus subsp. aureus str. JKD6008

This feature in The SEED Viewer

NCBI Taxonomy Id: 546342

Current Assignment: L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA
Translate Function Assignments



Context on contig NZ_ABRZ01000066 from base 27408 to 38920 (11513 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1513 27599 27408 192 -           FIG01108752: hypothetical protein locus|SauraJK_010100007568, protein_id|ZP_03563292.1, gi|221138490, CDD:115427
1514 27925 27674 252 - 74         Antitoxin DinJ (binds YafQ toxin) locus|SauraJK_010100007573, protein_id|ZP_03563293.1, gi|221138491, CDD:111497
1515 28797 28198 600 - 272         Protein-disulfide isomerase, related to DsbA locus|SauraJK_010100007578, protein_id|ZP_03563294.1, gi|221138492, CDD:31837
1516 29178 28816 363 - 18         FIG01108076: hypothetical protein locus|SauraJK_010100007583, protein_id|ZP_03563295.1, gi|221138493
1517 29433 30683 1251 + 254         FmhA protein of FemAB family locus|SauraJK_010100007588, protein_id|ZP_03563296.1, gi|221138494, CDD:111296
1518 31511 30780 732 - 96 23 1: 5   L-cystine ABC transporter, ATP-binding protein TcyC locus|SauraJK_010100007593, protein_id|ZP_03563297.1, gi|221138495, CDD:31323
1519 32227 31508 720 - -4 36     amino acid ABC transporter, permease protein locus|SauraJK_010100007598, protein_id|ZP_03563298.1, gi|221138496, CDD:31108
1520 32987 32208 780 - -20       L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA locus|SauraJK_010100007603, protein_id|ZP_03563299.1, gi|221138497, CDD:109548
1521 34547 33108 1440 - 120         FIG01107989: hypothetical protein locus|SauraJK_010100007608, protein_id|ZP_03563300.1, gi|221138498, CDD:116304
1522 34721 34825 105 + 173         hypothetical protein locus|SauraJK_010100007613, protein_id|ZP_03563301.1, gi|221138499
1523 35665 34979 687 - 153     1: 1   Phosphoglycerate mutase (EC 5.4.2.11) locus|SauraJK_010100007618, protein_id|ZP_03563302.1, gi|221138500, CDD:30933
1524 36858 35992 867 - 326     3: 3 2 4 dlit(30808698)
dlit(19226325)
Cation diffusion facilitator MntE locus|SauraJK_010100007623, protein_id|ZP_03563303.1, gi|221138501, CDD:30402
1525 37610 38920 1311 + 751         IgG-binding protein SBI locus|SauraJK_010100007628, protein_id|ZP_03563304.1, gi|221138502, CDD:111144

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|546342.3.peg.1520 L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA
MKRLLFVMIAFVFILAACGNNSSKDKEASKDSKTINVGTEGTYAPFSFHDKDGKLTGYDI
DVIKAVAKEEGLKLKFNETSWDSMFAGLDAGRFDVIANQVGINPDREKKYKFSKPYTFSS
AVLVIRENEKDIKDFDDVKGKKLAQTFTSNYGKLAKDKGADITKVDGFNQSMDLLLSKRV
DGTFNDSLSYLDYKKQKPNAKIKAIKGNAEQSRSAFAFSKKADDETVQKFNDGLKKIEEN
GELAKIGKKWFGQDVSKSK

MD5 = 666837dbe7c757f98a97dcf55c333bb5


  DNA Sequence

>fig|546342.3.peg.1520 L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA
atgaaaagacttttatttgtgatgatagctttcgttttcatattggctgcatgcggaaac
aattcgtcgaaagacaaggaagctagtaaagatagcaagacaattaatgttgggactgag
gggacttatgcaccatttagtttccacgataaagatggtaaattaactggttacgatatt
gatgttattaaagcagtggctaaagaagaaggtttaaaacttaaatttaatgaaacttct
tgggattctatgtttgcaggtttagacgcagggcgttttgatgtaatcgcgaaccaagta
ggtattaatcctgatagagaaaagaaatataaattttctaagccttacacattctcaagt
gctgttttagttattcgtgaaaatgaaaaagatattaaagattttgatgatgttaaaggt
aagaagttagcacaaacattcacatctaattatggtaaattagctaaggataaaggtgct
gatattacaaaagttgatggctttaaccaatcaatggatttattattgtctaagcgtgtt
gatggtacatttaatgatagtctgtcatacttggattataaaaaacaaaaacctaatgct
aagatcaaagcaatcaaaggtaatgctgaacaaagtagatctgcatttgcattttctaaa
aaagcagatgatgaaacagttcaaaaattcaatgatggcttgaaaaaaatcgaggaaaac
ggtgaattagctaaaataggtaagaaatggtttggtcaagatgtttctaaatctaaatag


  DNA with Flanking Sequence

>fig|546342.3.peg.1520 L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA
tgttggcaacagtttatgcgattcgaatggttggtatcgcgttaggattaattccagtaa
tgacccatacgatgaatcaattaaagccagaaatgaatgcacatggttcatctatgacaa
acacagtacaacaaattgctggttctatcggaacagctgcattaattactattttatccc
atgcaagcaaaaacttttctccaactatgtcagactataatggcatgaacaaaattgata
tgatgaatcaaattaaagttgatacgatgttgcatggttatcacgctggatttttatttg
cattattgattacagttgttagtttcttttgttcatttatgttacaaggtaagaaaaaag
aagttgattctcgtcaataaatataagttgctagctatataaagctttttagcaaaagtt
caacatattgacttatccggcatttcagattaaaatatttttattccgattagaataata
agaataaggagatatattctatgaaaagacttttatttgtgatgatagctttcgttttca
tattggctgcatgcggaaacaattcgtcgaaagacaaggaagctagtaaagatagcaaga
caattaatgttgggactgaggggacttatgcaccatttagtttccacgataaagatggta
aattaactggttacgatattgatgttattaaagcagtggctaaagaagaaggtttaaaac
ttaaatttaatgaaacttcttgggattctatgtttgcaggtttagacgcagggcgttttg
atgtaatcgcgaaccaagtaggtattaatcctgatagagaaaagaaatataaattttcta
agccttacacattctcaagtgctgttttagttattcgtgaaaatgaaaaagatattaaag
attttgatgatgttaaaggtaagaagttagcacaaacattcacatctaattatggtaaat
tagctaaggataaaggtgctgatattacaaaagttgatggctttaaccaatcaatggatt
tattattgtctaagcgtgttgatggtacatttaatgatagtctgtcatacttggattata
aaaaacaaaaacctaatgctaagatcaaagcaatcaaaggtaatgctgaacaaagtagat
ctgcatttgcattttctaaaaaagcagatgatgaaacagttcaaaaattcaatgatggct
tgaaaaaaatcgaggaaaacggtgaattagctaaaataggtaagaaatggtttggtcaag
atgtttctaaatctaaatagcgaacaacaacatgcgctagatgctgcaaaacaagctttc
ggacctatgctagaaggtttggtcaaatattcaattcctattacattagttacatttgtt
ttaggattgattattgcattatttacagcattaatgcgaatttcaacgagtaaaatttta
agaagtatttcacgtgtctatgtatctattattcgaggaacaccaatgatagtacaacta
tttatcatattttatggtattccagaattaggtagattattaacaaatgacgctgacaac
caatggacattggcacctgtagtggctgctattattggtttatcattaaatgtaggtgcg
tatgcttcggaaattattcgtggcggtattatttctataccgaaaggacaaacagaagct
gcatattccatcggtatgacgtatggtcaaacgatacaacgtatcattttaccgcaggca
attcgagtgtcgattcctgcactaggtaatacatttttaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005215       F:transporter activity
GO:0006810       P:transport
GO:0030288       C:outer membrane-bounded periplasmic space
cmr|NT03SA2515 Staphylococcus aureus MW2     amino acid ABC transporter, substrate-binding protein
cmr|NT05SA2434 Staphylococcus aureus NCTC 8325     probable amino-acid ABC transporter extracellular-binding protein yckK
cmr|NT09SA2315 Staphylococcus aureus subsp. aureus MSSA476     amino acid ABC transporter, permease protein
cmr|SACOL2412 Staphylococcus aureus subsp. aureus COL     amino acid ABC transporter, amino acid-binding protein
cmr|SAUSA300_2359 Staphylococcus aureus subsp. aureus USA300-FPR3757     amino acid ABC transporter, amino acid-binding protein
dbj|BAB96201.1 Staphylococcus aureus subsp. aureus MW2     MW2336
dbj|BAF68585.1 Staphylococcus aureus subsp. aureus str. Newman     amino acid ABC transporter, amino acid-binding protein
emb|CAG44118.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   extracellular solute-binding lipoprotein
fig|196620.1.peg.2336 Staphylococcus aureus subsp. aureus MW2 FIG   L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA
fig|196620.5.peg.2413 Staphylococcus aureus subsp. aureus MW2 FIG   L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA
fig|282459.1.peg.2283 Staphylococcus aureus subsp. aureus MSSA476 FIG   L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA
fig|282459.5.peg.2397 Staphylococcus aureus subsp. aureus MSSA476 FIG   L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA
fig|367830.3.peg.510 Staphylococcus aureus subsp. aureus USA300 FIG   L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA
fig|426430.6.peg.2240 Staphylococcus aureus subsp. aureus str. Newman FIG   L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA
fig|426430.8.peg.2515 Staphylococcus aureus subsp. aureus str. Newman FIG   L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA
fig|450394.6.peg.2198 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA
fig|451515.3.peg.2517 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA
fig|451516.9.peg.2506 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA
fig|452948.4.peg.539 Staphylococcus aureus 930918-3 FIG   L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA
fig|455227.3.peg.796 Staphylococcus aureus D30 FIG   L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA
fig|546343.3.peg.1338 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA
fig|548475.3.peg.1753 Staphylococcus aureus subsp. aureus TCH70 FIG   L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA
fig|553567.3.peg.767 Staphylococcus aureus A5948 FIG   L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA
fig|553590.4.peg.1020 Staphylococcus aureus A9754 FIG   L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA
fig|553594.3.peg.371 Staphylococcus aureus A9765 FIG   L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA
fig|644279.4.peg.2557 Staphylococcus aureus subsp. aureus 132 FIG   L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA
fig|762962.3.peg.2094 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA
fig|93061.3.peg.2553 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA
fig|93061.5.peg.2445 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA
fig|93062.19.peg.2355 Staphylococcus aureus subsp. aureus COL FIG   L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA
fig|93062.4.peg.2469 Staphylococcus aureus subsp. aureus COL FIG   L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA
gb|AAW37237.1 Staphylococcus aureus subsp. aureus COL     amino acid ABC transporter, amino acid-binding protein
gb|ABD22685.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     amino acid ABC transporter, amino acid-binding protein
gb|ABD31707.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABX30385.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     amino acid ABC superfamily ATP binding cassette transporter, binding protein
gb|EES55990.1 Staphylococcus aureus subsp. aureus TCH70     amino acid ABC superfamily ATP binding cassette transporter, binding protein
gb|EES94903.1 Staphylococcus aureus subsp. aureus USA300_TCH959     amino acid ABC superfamily ATP binding cassette transporter, binding protein
gb|EEV83888.1 Staphylococcus aureus A5948     extracellular solute-binding protein family 3
gb|EEW45573.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1334
gb|EEW47641.1 Staphylococcus aureus D30     hypothetical protein SAD30_0669
gi|150375325 Staphylococcus aureus subsp. aureus str. Newman NCBI   amino acid ABC transporter, amino acid-binding protein
gi|151222525 Staphylococcus aureus subsp. aureus str. Newman NCBI   amino acid ABC transporter, amino acid-binding protein
gi|160369414 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   amino acid ABC superfamily ATP binding cassette transporter, binding protein
gi|161510605 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   amino acid ABC transporter ATP-binding protein
gi|21205508 Staphylococcus aureus subsp. aureus MW2 NCBI   MW2336
gi|21284065 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW2336
gi|221138497 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   amino acid ABC transporter ATP-binding protein
gi|221141308 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   amino acid ABC transporter ATP-binding protein
gi|251803333 Staphylococcus aureus subsp. aureus TCH70 NCBI   amino acid ABC superfamily ATP binding cassette transporter, binding protein
gi|251813150 Staphylococcus aureus subsp. aureus TCH70 NCBI   amino acid ABC superfamily ATP binding cassette transporter, binding protein
gi|253726174 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   amino acid ABC superfamily ATP binding cassette transporter, binding protein
gi|253730087 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   amino acid ABC superfamily ATP binding cassette transporter, binding protein
gi|257861073 Staphylococcus aureus A5948 NCBI   extracellular solute-binding protein family 3
gi|258451281 Staphylococcus aureus A5948 NCBI   extracellular solute-binding protein family 3
gi|259160550 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1334
gi|259163080 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_0669
gi|49245639 Staphylococcus aureus subsp. aureus MSSA476 NCBI   extracellular solute-binding lipoprotein
gi|49487196 Staphylococcus aureus subsp. aureus MSSA476 NCBI   extracellular solute-binding lipoprotein
gi|57285143 Staphylococcus aureus subsp. aureus COL NCBI   amino acid ABC transporter, amino acid-binding protein
gi|57650957 Staphylococcus aureus subsp. aureus COL NCBI   amino acid ABC transporter, amino acid-binding protein
gi|87128171 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   amino acid ABC transporter, amino acid-binding protein
gi|87162197 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   amino acid ABC transporter, amino acid-binding protein
gi|87203897 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88196339 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_02699
img|637153168 Staphylococcus aureus aureus COL IMG   amino acid ABC transporter, amino acid-binding protein
img|637158574 Staphylococcus aureus aureus MSSA476 IMG   extracellular solute-binding lipoprotein
img|637300153 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637889002 Staphylococcus aureus aureus USA300 IMG   amino acid ABC transporter, amino acid-binding protein
img|637895310 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640796744 Staphylococcus aureus aureus Newman IMG   amino acid ABC transporter, amino acid-binding protein
img|641310399 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   amino acid ABC superfamily ATP binding cassette transporter, binding protein
img|641773040 Staphylococcus aureus aureus USA300_TCH959 IMG   amino acid ABC superfamily ATP binding cassette transporter, binding protein
kegg|saa:SAUSA300_2359 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   amino acid ABC transporter, amino acid-binding protein
kegg|sac:SACOL2412 Staphylococcus aureus subsp. aureus COL KEGG   amino acid ABC transporter, amino acid-binding protein
kegg|sae:NWMN_2313 Staphylococcus aureus subsp. aureus Newman KEGG   amino acid ABC transporter, amino acid-binding protein
kegg|sam:MW2336 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_02699 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sas:SAS2305   KEGG   extracellular solute-binding lipoprotein
kegg|sax:USA300HOU_2395 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   amino acid ABC transporter ATP-binding protein
ref|NP_647153.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW2336
ref|YP_001333347.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   amino acid ABC transporter, amino acid-binding protein
ref|YP_001576264.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   amino acid ABC transporter ATP-binding protein
ref|YP_044417.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   extracellular solute-binding lipoprotein
ref|YP_187215.1 Staphylococcus aureus subsp. aureus COL RefSeq   amino acid ABC transporter, amino acid-binding protein
ref|YP_494994.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   amino acid ABC transporter, amino acid-binding protein
ref|YP_501161.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_02699
ref|ZP_03563299.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   amino acid ABC transporter ATP-binding protein
ref|ZP_03565801.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   amino acid ABC transporter ATP-binding protein
ref|ZP_04827623.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   amino acid ABC superfamily ATP binding cassette transporter, binding protein
ref|ZP_04864252.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   amino acid ABC superfamily ATP binding cassette transporter, binding protein
ref|ZP_05699314.1 Staphylococcus aureus A5948 RefSeq   extracellular solute-binding protein family 3
tr|A6QJQ3 Staphylococcus aureus (strain Newman) TrEMBL   Amino acid ABC transporter, amino acid-binding protein
tr|A8Z5A2 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Amino acid ABC superfamily ATP binding cassette transporter, binding protein
tr|C5MZW0 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Amino acid ABC superfamily ATP binding cassette transporter, binding protein
tr|C5QFQ7 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Amino acid ABC superfamily ATP binding cassette transporter, binding protein
tr|Q2FE84 Staphylococcus aureus (strain USA300) TrEMBL   Amino acid ABC transporter, amino acid-binding protein
tr|Q2FVL2 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HDE2 Staphylococcus aureus (strain COL) TrEMBL   Amino acid ABC transporter, amino acid-binding protein
tr|Q6G6Q7 Staphylococcus aureus (strain MSSA476) TrEMBL   Extracellular solute-binding lipoprotein
tr|Q8NV12 Staphylococcus aureus (strain MW2) TrEMBL   MW2336 protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
23 fig|546342.3.peg.1518 L-cystine ABC transporter, ATP-binding protein TcyC
36 fig|546342.3.peg.1519 amino acid ABC transporter, permease protein


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search