The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|537021.9.peg.4: Liberibacter asiaticus str. psy62

This feature in The SEED Viewer

NCBI Taxonomy Id: 537021

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig NC_012985 from base 156 to 8363 (8208 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1 156 407 252 +       1: 1   hypothetical protein locus|CLIBASIA_00005, protein_id|YP_003064535.1, gi|254780122, geneID|8210255
2 548 820 273 + 140     1: 1   hypothetical protein locus|CLIBASIA_00010, protein_id|YP_003064536.1, gi|254780123, geneID|8209098
3 948 2114 1167 + 127         Phage protein locus|CLIBASIA_00015, protein_id|YP_003064537.1, gi|254780124, geneID|8209099
4 2285 3073 789 + 170       Phage antirepressor protein locus|CLIBASIA_00020, protein_id|YP_003064538.1, gi|254780125, geneID|8209100
5 3091 3741 651 + 17     1: 1   Phage protein locus|CLIBASIA_00025, protein_id|YP_003064539.1, gi|254780126, geneID|8209101
6 3745 5772 2028 + 3     3: 5 3 6   Phage DNA polymerase I (EC 2.7.7.7) locus|CLIBASIA_00030, protein_id|YP_003064540.1, gi|254780127, geneID|8209102
7 5769 6080 312 + -4     1: 1   Phage protein locus|CLIBASIA_00035, protein_id|YP_003064541.1, gi|254780128, geneID|8209103
8 6065 6727 663 + -16 4     Phage DNA helicase (EC 3.6.4.12) locus|CLIBASIA_00040, protein_id|YP_003064542.1, gi|254780129, geneID|8209104
9 6832 7449 618 + 104         Phage DNA helicase (EC 3.6.4.12) locus|CLIBASIA_00045, protein_id|YP_003064543.1, gi|254780130, geneID|8209105
10 7442 7801 360 + -8         DNA ligase, NAD-dependent locus|CLIBASIA_00050, protein_id|YP_003064544.1, gi|254780131, geneID|8209106
11 7767 8363 597 + -35     2: 2 4   Guanylate kinase-like protein gene_name|gmk, locus|CLIBASIA_00055, protein_id|YP_003064545.1, gi|254780132, geneID|8209107

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|537021.9.peg.4 Phage antirepressor protein
MSTITPFEFESNKIRTIVDKDQNIWFVAKDVATALGYENSNEAINAHCKGVAKRYPLKTE
GGIQKVRIISEPDVYRLLVKSTLPSAQKFERWVFEEVLPTLRKTGSYSVEAPKLRATSAS
TVLRVHKHLEELAKQAGLKDNQLLLKVNRGVTKITGVDQLEAMDIKHLPSSDNDEYLTIT
QIGERLNPPQRARFLNKLLLKRGLQVSKVSGGYRPTPKGEERGGKMCDVPMQHVEGSTQQ
LKWNSNLLVSFLQNELINTPRL

MD5 = ad8bc363aa3a9c6282fe02c13865ec8f


  DNA Sequence

>fig|537021.9.peg.4 Phage antirepressor protein
atgagcactataaccccttttgaatttgaaagcaacaagatccgtactattgtggataaa
gaccagaatatatggtttgtggctaaagatgtcgctacggctttagggtatgaaaattca
aatgaagcaataaacgctcattgcaagggggtagcaaaacgctacccccttaagactgaa
ggcggaatacaaaaagtccgtatcatatcagaacctgatgtttacaggttactggttaaa
agcacgttaccatcagcacagaagtttgagcgttgggtatttgaggaggtgttacctact
cttcgcaaaacaggcagttattcggttgaagcaccgaagcttagagccacttcagcgagt
acagttttaagagttcacaaacatcttgaagaactagccaagcaagcaggattaaaagac
aatcaacttttgttgaaggttaaccgaggcgttacgaagataacaggtgttgatcagtta
gaggctatggatatcaaacacctaccctcttccgataacgacgaatatttaacaattacc
caaataggggaaaggcttaacccacctcagagagcgagatttttaaacaaacttcttctt
aagcgaggactgcaagttagcaaggtctcaggtggctatagaccgacacctaaaggtgaa
gagcgtggaggcaagatgtgtgatgtgcccatgcagcatgttgaaggctcaacccagcaa
ttaaaatggaattcgaatttactcgtttcgtttcttcaaaacgaattaattaacacacca
cgcctataa


  DNA with Flanking Sequence

>fig|537021.9.peg.4 Phage antirepressor protein
gagatgtttaaacggttgaatgctggggatgaaatacaagggtatcaactagtcgaagga
cgcaaaggaaatcgaagttttaaggatattaaccgagcgcaagagctgttgacatcagtt
ttaggggaagaagcgtttaagcgaattctcaaaactcctaaagaattggagcaattgtat
aaggagcaaaaggtttctgatgaattttgggaagagttgcaagagttgatcacgagaggc
gacggcaagcctgtcatcgccccccgagatataccaacaaacaaacaaacccaaaaatcg
caattaagcgagttcgaggtactaggctagaaaggatcaaagttatgataaatataacac
cttttgaagaattcaatataacgagcgatataccagaaataacgaaagaagtcaatagac
tacgtaatgtttaacgatatcgaagtttcacggctcaaatttgagccgtcagatttggaa
agtatagaaaggatcaaacgatgagcactataaccccttttgaatttgaaagcaacaaga
tccgtactattgtggataaagaccagaatatatggtttgtggctaaagatgtcgctacgg
ctttagggtatgaaaattcaaatgaagcaataaacgctcattgcaagggggtagcaaaac
gctacccccttaagactgaaggcggaatacaaaaagtccgtatcatatcagaacctgatg
tttacaggttactggttaaaagcacgttaccatcagcacagaagtttgagcgttgggtat
ttgaggaggtgttacctactcttcgcaaaacaggcagttattcggttgaagcaccgaagc
ttagagccacttcagcgagtacagttttaagagttcacaaacatcttgaagaactagcca
agcaagcaggattaaaagacaatcaacttttgttgaaggttaaccgaggcgttacgaaga
taacaggtgttgatcagttagaggctatggatatcaaacacctaccctcttccgataacg
acgaatatttaacaattacccaaataggggaaaggcttaacccacctcagagagcgagat
ttttaaacaaacttcttcttaagcgaggactgcaagttagcaaggtctcaggtggctata
gaccgacacctaaaggtgaagagcgtggaggcaagatgtgtgatgtgcccatgcagcatg
ttgaaggctcaacccagcaattaaaatggaattcgaatttactcgtttcgtttcttcaaa
acgaattaattaacacaccacgcctataatagaaaggaatttaataatgcaaaaactaac
tgtaaaaggacgtctatcataccctgctcttgatacgaaggtgcgtatgaagctccctga
tggctcaagtgttgagcactacggctgtgatatcgtctttccgaaagcggatacgaagca
gattaacgctgttgaggcgtgtttaaagaccgctgttaccgagatatttccgaatgtctc
tccggatgcgtttttgtcggcggttcgaagcaaatcggaatcccgtggggttttgaggga
cggcgatgcgaagatcgcttcttctcacaagcctgagaattacacacaaacatacacaga
cagcgtgtatatctcggcgaagaacaaatatgttcaaccgttactcgtggatcgtcaagc
gcaacctgtgagcgatccgagggaggttttttatccggggtgttgggtcattgcgaagct
taacatcggggcgtatgagcttgatccgtacaaaaccaagggtttcagt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
gb|ACT56598.1 Candidatus Liberibacter asiaticus str. psy62     prophage antirepressor
gi|254039802 Candidatus Liberibacter asiaticus str. psy62 NCBI   prophage antirepressor
gi|254780125 Candidatus Liberibacter asiaticus str. psy62 NCBI   prophage antirepressor
kegg|las:CLIBASIA_00020 Candidatus Liberibacter asiaticus psy62 KEGG   prophage antirepressor
ref|YP_003064538.1 Candidatus Liberibacter asiaticus str. psy62 RefSeq   prophage antirepressor
tr|B6F5J5 Candidatus Liberibacter asiaticus str. psy62 TrEMBL   Prophage antirepressor


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|537021.9.peg.8 Phage DNA helicase (EC 3.6.4.12)


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search