The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|537021.9.peg.2: Liberibacter asiaticus str. psy62

This feature in The SEED Viewer

NCBI Taxonomy Id: 537021

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NC_012985 from base 156 to 6080 (5925 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1 156 407 252 +       1: 1   hypothetical protein locus|CLIBASIA_00005, protein_id|YP_003064535.1, gi|254780122, geneID|8210255
2 548 820 273 + 140     1: 1   hypothetical protein locus|CLIBASIA_00010, protein_id|YP_003064536.1, gi|254780123, geneID|8209098
3 948 2114 1167 + 127         Phage protein locus|CLIBASIA_00015, protein_id|YP_003064537.1, gi|254780124, geneID|8209099
4 2285 3073 789 + 170         Phage antirepressor protein locus|CLIBASIA_00020, protein_id|YP_003064538.1, gi|254780125, geneID|8209100
5 3091 3741 651 + 17     1: 1   Phage protein locus|CLIBASIA_00025, protein_id|YP_003064539.1, gi|254780126, geneID|8209101
6 3745 5772 2028 + 3     3: 3 2 4   Phage DNA polymerase I (EC 2.7.7.7) locus|CLIBASIA_00030, protein_id|YP_003064540.1, gi|254780127, geneID|8209102
7 5769 6080 312 + -4     1: 1   Phage protein locus|CLIBASIA_00035, protein_id|YP_003064541.1, gi|254780128, geneID|8209103

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
DHQS_phosphatase_fusion Thamm_Antje_user hypothetical protein


  Protein Sequence

>fig|537021.9.peg.2 hypothetical protein
MLTFLSLITQGLQEALITQDVKAVEAVDPDLKKRVTVLAISYMKRCGDKGKSQFLSEILV
PALGTHKTFVDCTDEDFRLVEAKLLEQSDA

MD5 = 3c9531a5fba621a17f5b8a757166cae8


  DNA Sequence

>fig|537021.9.peg.2 hypothetical protein
ttgttaacttttctttctttgatcactcaagggttgcaggaggctttaatcacccaagat
gttaaagccgttgaagcggtggatccagacctcaagaagagagtcacggttttagctata
tcctacatgaagagatgtggtgataaggggaaatcgcagtttttatccgagattttggtc
cctgctttaggaacgcataaaacttttgtcgattgcacagatgaggattttagattggtg
gaagcgaagttattggagcaaagcgatgcatga


  DNA with Flanking Sequence

>fig|537021.9.peg.2 hypothetical protein
aagaatcattttcatgacgagattaacgagaacttttactttcatagtcatccgaacgca
gatccagatataagtattgagatgcagattagcgagaatcagcggtatttggatgaagag
atatcgcagtgcaatgcggtagttgatgtttttaaaaggtctgattccaccattttagac
aagctagatgcgatggatgacctaaaaacttacatttctcttctgcaagctacggctaaa
aatctcaagtcattgcttaaggaatattgggaagagtctttggacggagaggacgacgaa
gagatttatgagcatcctgatcaagagcatagagaagattattatgccaatcagatttaa
gagatccccagtgatgggttcagggggtggatgtttatatctccgtccatccccaacaaa
taaaagtgtaagagcgggagcgagtgaggatgagcgtacattttattgaagaggcggtta
aagccaaggacataccacagttgttaacttttctttctttgatcactcaagggttgcagg
aggctttaatcacccaagatgttaaagccgttgaagcggtggatccagacctcaagaaga
gagtcacggttttagctatatcctacatgaagagatgtggtgataaggggaaatcgcagt
ttttatccgagattttggtccctgctttaggaacgcataaaacttttgtcgattgcacag
atgaggattttagattggtggaagcgaagttattggagcaaagcgatgcatgattgcttt
ttcaccattggggttctgatttttattgtcgttatggtttatttatcacttcccgagaga
tcctgacgataccacccccgcttaaacgagagttgaataaatttaagagagtgaagatta
atggcacaccatgcatttttatcggcttcaagcagtcatcgttggctaaaatgtcctata
gccccgacgcttgagagcaaaatacctcaaacaacaagtatatacgcctctgaaggcact
tttgcccataatcttttagcgcattgcctcgaacaaggcgttgatgcagagacagtttct
catcaaaagctgacttttgagaacgatacccgcattgttgatacggaaatggcgtctagt
gtctcgatggttttagcgtatgtccgcactttttctggaccatttttatcggaaaccgaa
gttccccttgagccttttacaacggaacccggggcaactggcactgcggatattcttatt
tttaatagcactc


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search