The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|536232.3.peg.2434: Clostridium botulinum A2 str. Kyoto

This feature in The SEED Viewer

NCBI Taxonomy Id: 536232

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig NC_012563 from base 2602156 to 2614307 (12152 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2421 2603034 2602156 879 -           Phage protein locus|CLM_2560, protein_id|YP_002804714.1, gi|226949623, geneID|7767698
2422 2603285 2603046 240 - 11         FIG00520478: hypothetical protein locus|CLM_2561, protein_id|YP_002804715.1, gi|226949624, geneID|7767479
2423 2604105 2603302 804 - 16     1: 1   Helicase loader DnaI locus|CLM_2562, protein_id|YP_002804716.1, gi|226949625, geneID|7766929
2424 2604937 2604065 873 - -41         Phage replication initiation locus|CLM_2563, protein_id|YP_002804717.1, gi|226949626, geneID|7765296
2425 2605259 2604960 300 - 22         FIG00520978: hypothetical protein locus|CLM_2564, protein_id|YP_002804718.1, gi|226949627, geneID|7764742
2426 2605529 2605353 177 - 93         FIG00533413: hypothetical protein locus|CLM_2565, protein_id|YP_002804719.1, gi|226949628, geneID|7768104
2427 2605691 2605545 147 - 15         FIG00516092: hypothetical protein locus|CLM_2566, protein_id|YP_002804720.1, gi|226949629, geneID|7765553
2428 2606554 2605694 861 - 2         FIG00518854: hypothetical protein locus|CLM_2567, protein_id|YP_002804721.1, gi|226949630, geneID|7765878
2429 2607051 2606566 486 - 11         FIG00523380: hypothetical protein locus|CLM_2568, protein_id|YP_002804722.1, gi|226949631, geneID|7767488
2430 2607347 2607183 165 - 131         FIG00523113: hypothetical protein locus|CLM_2569, protein_id|YP_002804723.1, gi|226949632, geneID|7766197
2431 2607514 2607356 159 - 8         hypothetical protein locus|CLM_2570, protein_id|YP_002804724.1, gi|226949633, geneID|7765683
2432 2607719 2607567 153 - 52         hypothetical protein locus|CLM_2571, protein_id|YP_002804725.1, gi|226949634, geneID|7764994
2433 2607949 2607740 210 - 20         hypothetical protein locus|CLM_2572, protein_id|YP_002804726.1, gi|226949635, geneID|7767183
2434 2608749 2607961 789 - 11         Phage antirepressor protein locus|CLM_2573, protein_id|YP_002804727.1, gi|226949636, geneID|7766092
2435 2609024 2608803 222 - 53         hypothetical protein locus|CLM_2574, protein_id|YP_002804728.1, gi|226949637, geneID|7765422
2436 2609157 2609615 459 + 132         transcriptional regulator, XRE family locus|CLM_2575, protein_id|YP_002804729.1, gi|226949638, geneID|7764357
2437 2609662 2610096 435 + 46         Phage repressor protein locus|CLM_2576, protein_id|YP_002804730.1, gi|226949639, geneID|7767058
2438 2610239 2611600 1362 + 142         Chromosome segregation ATPase locus|CLM_2577, protein_id|YP_002804731.1, gi|226949640, geneID|7765933
2439 2611695 2613317 1623 + 94         Site-specific recombinases, DNA invertase Pin homolog locus|CLM_2578, protein_id|YP_002804732.1, gi|226949641, geneID|7764557
2440 2613681 2614307 627 + 363         Electron transfer subunit protein locus|CLM_2579, protein_id|YP_002804733.1, gi|226949642, geneID|7767907

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|536232.3.peg.2434 Phage antirepressor protein
MSNLQIFKNQQLIALNQNKNGEVIISGRELHEFLEIGTQYTKWFERMKEYGFVENQDFAT
ISQKRLTAQGNETTYTDHAIKLDMAKELAMIQRNEKGKQARQYFIVVEKAWNSPEMIMKR
ALEIANRNVQNLKLENEEQKQQLKKQKPKVLFADAVSVAHTSILVGDLAKLIKQNGIDIG
AKRLFAWLRENGYLIRRKGTDYNMPTQYSMDLGLFEVKETSITHSDGHISISKTPKITGK
GQIYFINKFVEKQTKSEIACTK

MD5 = 65fbe2da80ded8cb9f328fb27eeb4ea0


  DNA Sequence

>fig|536232.3.peg.2434 Phage antirepressor protein
gtgagtaacttacagatttttaaaaatcaacaacttatagcacttaatcaaaataaaaat
ggagaagtgataataagtggtagagaattacatgagtttttagaaataggaactcaatat
acaaagtggttcgaaagaatgaaagaatatggttttgttgaaaatcaggactttgcaact
attagtcaaaaaagactaacagctcaaggtaatgaaacgacttatacagatcatgccata
aaattagacatggcaaaagagcttgcaatgatacaaagaaatgaaaaaggaaagcaagca
agacagtattttatagtggtagagaaagcatggaatagccctgaaatgataatgaaaaga
gcgctagaaattgctaatagaaatgtacaaaatttaaaactagaaaatgaagaacaaaag
cagcagcttaaaaagcaaaaacccaaagtactatttgcagatgcagtatcagttgcacat
acatcaattctagtaggagatttagcaaaattaattaagcaaaatggtatagatatagga
gctaaaagattatttgcttggttaagggaaaacggatacttaattagaagaaaaggaaca
gattataatatgccaactcaatatagtatggacttaggattatttgaagttaaggaaaca
tctattacacattcagatgggcatataagtataagtaagactccaaaaattactgggaaa
ggccagatatattttataaataagtttgtagaaaaacaaactaaaagcgagatagcttgt
actaaatag


  DNA with Flanking Sequence

>fig|536232.3.peg.2434 Phage antirepressor protein
agaatgacttatacctattaatttagaagcatttcttaagcttaattttaattcttttct
tttatttattaaaaaagcctgtaaatcattcattttaacacctcctcaatactattgtaa
tgcaaacattacaaaattaaaatgaaattttaaaaatatatgtataacttgcttgacaat
atgtaatactagtattacaataataaatgtaaggaggtggacttcatgaagaacaaacta
aaaaaattacgacttcaattcggtttaacacaaggggaattagcacaaaaactcaaagta
gcaaggcctactatttctaatatagaaagagaaatatatactcctagtggttcgttgatg
atacgtatagctaatttttttggaaaaccagcagaacaaattttttttgaagatagtgta
atgcaggaagaacaaaagattatttaactatagtttatgtagttcttaaaaaattacttt
agtaaaagggaggatgtagggtgagtaacttacagatttttaaaaatcaacaacttatag
cacttaatcaaaataaaaatggagaagtgataataagtggtagagaattacatgagtttt
tagaaataggaactcaatatacaaagtggttcgaaagaatgaaagaatatggttttgttg
aaaatcaggactttgcaactattagtcaaaaaagactaacagctcaaggtaatgaaacga
cttatacagatcatgccataaaattagacatggcaaaagagcttgcaatgatacaaagaa
atgaaaaaggaaagcaagcaagacagtattttatagtggtagagaaagcatggaatagcc
ctgaaatgataatgaaaagagcgctagaaattgctaatagaaatgtacaaaatttaaaac
tagaaaatgaagaacaaaagcagcagcttaaaaagcaaaaacccaaagtactatttgcag
atgcagtatcagttgcacatacatcaattctagtaggagatttagcaaaattaattaagc
aaaatggtatagatataggagctaaaagattatttgcttggttaagggaaaacggatact
taattagaagaaaaggaacagattataatatgccaactcaatatagtatggacttaggat
tatttgaagttaaggaaacatctattacacattcagatgggcatataagtataagtaaga
ctccaaaaattactgggaaaggccagatatattttataaataagtttgtagaaaaacaaa
ctaaaagcgagatagcttgtactaaataggaggtaacagtatggaagatataaaggtaac
tgttacacaagagaaaagagaagaaacaatagataagatattagatcttgtagaaaaaga
atttaaaggtatagatgttacagcagtatttactaaaaagctgttagaggacactgtaag
aactttagaaaacagatgtatggaaacatcacttagatttataaataaaggggtaaatga
ggggcactaaaccaataggaggaaaatgaaatgttagaaaatatgaatgagtttagatgt
ccaaaatgccaaaaattgttatttaaatataaattaaaaggagaattaaatctagaaatt
aagtgcacaagatgtagaacatttactaatacagcactaaataaaaataactttaacaaa
taggtacgatttttcataagatgaataataactaagtaaagagaggaggagaactatggc
caaaattaaaaaaattatagtgaactatccagaagacccaaaagtaatg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
gb|ACO84611.1 Clostridium botulinum A2 str. Kyoto     phage antirepressor protein
gi|226841945 Clostridium botulinum A2 str. Kyoto NCBI   phage antirepressor protein
gi|226949636 Clostridium botulinum A2 str. Kyoto NCBI   phage antirepressor protein
kegg|cby:CLM_2573 Clostridium botulinum A2 Kyoto KEGG   phage antirepressor protein
ref|YP_002804727.1 Clostridium botulinum A2 str. Kyoto RefSeq   phage antirepressor protein
tr|C1FRD9 Clostridium botulinum (strain Kyoto / Type A2) TrEMBL   Phage antirepressor protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search