The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|527027.3.peg.3738: Bacillus thuringiensis serovar pakistani str. T13001

This feature in The SEED Viewer

NCBI Taxonomy Id: 527027

Current Assignment: FIG01247337: hypothetical protein
Translate Function Assignments



Context on contig NZ_CM000750 from base 5459809 to 5471377 (11569 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
3729 5460702 5459809 894 -           response regulator aspartate phosphatase  
3730 5460903 5460784 120 - 81         hypothetical protein  
3731 5461757 5461251 507 - 347         hypothetical protein  
3732 5462737 5461829 909 - 71         hypothetical protein  
3733 5463252 5463037 216 - 299         Transglycosylase  
3734 5463637 5463425 213 - 172         Phage protein  
3735 5463899 5463624 276 - -14         Phage protein  
3736 5464184 5464068 117 - 168         hypothetical protein  
3737 5464893 5464519 375 - 334         Phage protein  
3738 5465762 5465289 474 - 395         FIG01247337: hypothetical protein  
3739 5466194 5466051 144 - 288         hypothetical protein  
3740 5466255 5466154 102 - -41         hypothetical protein  
3741 5466990 5466589 402 - 333         Antiphagocytic M protein  
3742 5467405 5467172 234 - 181         hypothetical protein  
3743 5467871 5467620 252 - 214         FIG01234478: hypothetical protein  
3744 5468302 5467871 432 - -1         Hypothetical protein, Lmo2306 homolog [Bacteriophage A118]  
3745 5469410 5468778 633 - 475     1: 2   DNA replication protein DnaC  
3746 5470398 5469541 858 - 130         primosome, DnaD subunit  
3747 5470541 5470404 138 - 5         FIG01232276: hypothetical protein  
3748 5471377 5470571 807 - 29     1: 1   Recombinational DNA repair protein RecT (prophage associated)  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|527027.3.peg.3738 FIG01247337: hypothetical protein
MTPPTINALLQDPDLLISLASQLKDEQQARHMAEQKNLMLTQQIAENESKMTYLDQILQS
KDTVTVSQIAADYGLSAVRLNKILKDEKVQYKVNNQWLLYAKHQNKGYTKSQTIDVTHSD
GSKSVKMNTRWTQKGRLFIHDMLTKRGIIPEMDKEAV

MD5 = 4f6d4c67df21801a0cc2cbb409e9afcb


  DNA Sequence

>fig|527027.3.peg.3738 FIG01247337: hypothetical protein
atgacaccgcctacgataaatgctttactgcaagatcctgatttattgattagccttgcg
tcacaattgaaagacgaacaacaagccagacatatggcggaacaaaagaatctgatgtta
acccagcagattgcagaaaatgaatcaaagatgacatacctcgatcaaattcttcaatca
aaagatacagtaaccgtttcacaaattgcggctgattatgggttatctgcagttcgatta
aataaaatcttaaaggatgaaaaagtacagtacaaagtaaacaatcaatggctgctgtat
gcgaaacatcaaaataaagggtatacaaaatcgcagacaattgatgtcacgcattcggat
gggagtaaatctgtaaaaatgaatacacgctggacacaaaaaggtaggttgtttatccat
gatatgttaacaaaacgaggaattattccggaaatggataaggaggcggtataa


  DNA with Flanking Sequence

>fig|527027.3.peg.3738 FIG01247337: hypothetical protein
atcgaaaatgagatggagaaaacaaggattgtgggaagggccgaatcaggtggcgaagaa
agtaaggaatgggacgagggatgaacgaaacgttagtccctctgaatagcagtaaacaaa
cgaaagaggatgggattgcgttttgcgaggggattatgttacatcggatgccttcgtcaa
aaaaatatagtacgaggggaaatgaaaaatgaatcaaacgcaaatgttttcacacaacat
gttcggtaacttagaaatcttaattcagaatggaaaagagtactttccagcgacagatgt
tgcgaaggtattgggatatacgaatcccacaaaagtggtaagagatcattgtaaaaagga
cggggtaacgttttattcggtggttatttcagagaagaatcaaacggttgaaaagaaatt
catcagcgaaccgaacttataccgtctaattgttaaatccaaacttcctcaagcagaaca
atttgaaacatggggcttacatgacaccgcctacgataaatgctttactgcaagatcctg
atttattgattagccttgcgtcacaattgaaagacgaacaacaagccagacatatggcgg
aacaaaagaatctgatgttaacccagcagattgcagaaaatgaatcaaagatgacatacc
tcgatcaaattcttcaatcaaaagatacagtaaccgtttcacaaattgcggctgattatg
ggttatctgcagttcgattaaataaaatcttaaaggatgaaaaagtacagtacaaagtaa
acaatcaatggctgctgtatgcgaaacatcaaaataaagggtatacaaaatcgcagacaa
ttgatgtcacgcattcggatgggagtaaatctgtaaaaatgaatacacgctggacacaaa
aaggtaggttgtttatccatgatatgttaacaaaacgaggaattattccggaaatggata
aggaggcggtataaattttatactgcagaaaaacgacatcatagaaccgggtaaattcgt
gtttgaatctttttggaataccctaggtattggatgaggggtaacgtgttaaaaagaagg
atagggcgtttaaatcaagaatagggattgtaacaaaaaagaggaacccttttgtaagag
ttcctaaagtagctagctgacaagctaacaagaaaaaacataataatgtatgtgtagcat
aatctaataaagcgaatgtatgcaaaataaaaacagctagctaaaactagctgtttttcc
gttctaaggaatgcagcgtttcgttaataattcaattaaggaagaaagccgcgccaaggc
ttagttacagtgtgcacgaaaaataagattgtatgcaggaggatgacacatgaatcaatt
atctttttttacatatgttgatgagaaagaaatccgtccttttgtgatagaagaattgaa
gaagtataaggtgttacgcgttcgttttcagaat


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
gb|EEM44546.1 Bacillus thuringiensis serovar pakistani str. T13001     KilA protein, putative phage-related DNA binding protein
gi|228797351 Bacillus thuringiensis serovar pakistani str. T13001 NCBI   KilA protein, putative phage-related DNA binding protein
gi|228962319 Bacillus thuringiensis serovar pakistani str. T13001 NCBI   KilA protein, putative phage-related DNA binding protein
ref|ZP_04123737.1 Bacillus thuringiensis serovar pakistani str. T13001 RefSeq   KilA protein, putative phage-related DNA binding protein
tr|C3ED09 Bacillus thuringiensis serovar pakistani str. T13001 TrEMBL   KilA protein, putative phage-related DNA binding protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search