The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on aspen.cels.anl.gov
The SEED


FIG search

Protein fig|526218.6.peg.1363: Sebaldella termitidis ATCC 33386

This feature in The SEED Viewer

NCBI Taxonomy Id: 526218

Current Assignment: Transcriptional regulator, MarR family
Translate Function Assignments



Context on contig NC_013517 from base 1418565 to 1428828 (10264 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1354 1418855 1418565 291 -           hypothetical protein locus|Sterm_1325, protein_id|YP_003308122.1, gi|269119945, geneID|8596802
1355 1419169 1418873 297 - 17         hypothetical protein locus|Sterm_1326, protein_id|YP_003308123.1, gi|269119946, InterPro:IPR002048, geneID|8596803
1356 1419915 1419265 651 - 95         hypothetical protein locus|Sterm_1327, protein_id|YP_003308124.1, gi|269119947, geneID|8596804
1357 1420482 1419916 567 - 0         hypothetical protein locus|Sterm_1328, protein_id|YP_003308125.1, gi|269119948, geneID|8596805
1358 1420586 1420948 363 + 103     4: 7 6 5 8   DNA processing protein DprA  
1359 1421255 1422157 903 + 306     2: 9 10   Oxidoreductase, aldo/keto reductase family locus|Sterm_1330, protein_id|YP_003308126.1, gi|269119949, InterPro:IPR001395, geneID|8599616
1360 1422356 1422832 477 + 198         Auxin-binding protein, putative locus|Sterm_1331, protein_id|YP_003308127.1, gi|269119950, InterPro:IPR006045, InterPro:IPR013096, geneID|8596807
1361 1423128 1422967 162 - 134         hypothetical protein locus|Sterm_1332, protein_id|YP_003308128.1, gi|269119951, geneID|8596808
1362 1423335 1423153 183 - 24         hypothetical protein locus|Sterm_1333, protein_id|YP_003308129.1, gi|269119952, geneID|8596809
1363 1423945 1423499 447 - 163     4: 2 3 4 1   Transcriptional regulator, MarR family locus|Sterm_1334, protein_id|YP_003308130.1, gi|269119953, InterPro:IPR000835, geneID|8596810
1364 1424239 1424829 591 + 293         hypothetical protein locus|Sterm_1335, protein_id|YP_003308131.1, gi|269119954, geneID|8596811
1365 1425469 1424993 477 - 163         Acetyltransferase, GNAT family locus|Sterm_1336, protein_id|YP_003308132.1, gi|269119955, InterPro:IPR000182, geneID|8596812
1366 1425749 1426234 486 + 279         hypothetical protein locus|Sterm_1337, protein_id|YP_003308133.1, gi|269119956, geneID|8596813
1367 1426513 1426647 135 + 278         hypothetical protein  
1368 1426599 1427159 561 + -49         hypothetical protein locus|Sterm_1338, protein_id|YP_003308134.1, gi|269119957, geneID|8596814
1369 1427516 1427265 252 - 105         hypothetical protein locus|Sterm_1339, protein_id|YP_003308135.1, gi|269119958, geneID|8596815
1370 1428171 1427545 627 - 28         EpiH/GdmH-related protein locus|Sterm_1340, protein_id|YP_003308136.1, gi|269119959, InterPro:IPR003848, geneID|8596816
1371 1428828 1428370 459 - 198     4: 2 3 4 1   Transcriptional regulator, MarR family locus|Sterm_1341, protein_id|YP_003308137.1, gi|269119960, InterPro:IPR000835, InterPro:IPR002831, geneID|8596817

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
AdiR Ernst_Dustin_user Transcriptional regulator, MarR family
All_RidA_Proteins Hodge_Kelsey_user Transcriptional regulator, MarR family
Gra Transcriptional regulator, MarR family
Amidohydrolase_-_Experimental Blaby_Crysten_user Transcriptional regulator, MarR family


  Protein Sequence

>fig|526218.6.peg.1363 Transcriptional regulator, MarR family
MLFINRNRYVMFAIKSLTLQLKRLLDESAANIEKDMTGIQAGIIAYINISSETGEVFQKD
IEEEFNIRRSTATGILNSLEKNDMLKRESVSYDKRLKKLVLTEKSNLFCKKIRETLIADE
KKLTENLTAEEIEFFLKIIAKMMKNIMY

MD5 = 092533ab5d84ce6119c3adf25899fa00


  DNA Sequence

>fig|526218.6.peg.1363 Transcriptional regulator, MarR family
gtgctttttattaatagaaatcgttatgtaatgtttgcaataaaatcattaacactccaa
ttaaaacgactgcttgatgaaagtgctgcaaatattgaaaaagacatgacgggtattcag
gcaggaattattgcatatattaatatttcaagtgaaacaggagaagtgtttcagaaagat
attgaagaagaatttaacataagacgttctacagcaactggtattctaaattctttagaa
aaaaacgatatgttaaaacgcgaatctgtttcatatgacaagcgcttaaaaaaattagtt
ttaacagaaaagtccaaccttttttgcaagaaaatccgtgaaacccttatagcggatgag
aaaaaattgactgaaaatcttacagcagaagaaatagaattttttttgaaaattattgca
aaaatgatgaaaaacattatgtattaa


  DNA with Flanking Sequence

>fig|526218.6.peg.1363 Transcriptional regulator, MarR family
ataagtaccattatagtctaaaactgtattcgaaatatcatctatgctaaaagaactttc
aaatactttttttggctgcttttcatttatttcttcctctaacgtttcttcaatacggtt
tttcggatctactatatccttttttttacagcttacaataaataaacctaaaaaaagaac
aaatactactaataataactttttcataaattttctccttattttttgttccattatact
ataaatattattttttgtaaaaactaatatcttttgacactaagaaaaattactttatta
gtgttttatcttccctacaatatattctctgttttaagttatataaaatctacattttag
ataaaacttttttagacttctgttcttactttcttaagctgcttatctgcagttttccaa
tttttttcaaaaaagtattgacaaaatattttttatgttatatacttagacatataattg
ttagggagcgaactaaggaggtgctttttattaatagaaatcgttatgtaatgtttgcaa
taaaatcattaacactccaattaaaacgactgcttgatgaaagtgctgcaaatattgaaa
aagacatgacgggtattcaggcaggaattattgcatatattaatatttcaagtgaaacag
gagaagtgtttcagaaagatattgaagaagaatttaacataagacgttctacagcaactg
gtattctaaattctttagaaaaaaacgatatgttaaaacgcgaatctgtttcatatgaca
agcgcttaaaaaaattagttttaacagaaaagtccaaccttttttgcaagaaaatccgtg
aaacccttatagcggatgagaaaaaattgactgaaaatcttacagcagaagaaatagaat
tttttttgaaaattattgcaaaaatgatgaaaaacattatgtattaaaatattccatcta
atattaaagatggttatttttcaaaacatattgttaggaacataactgttagcgcccgaa
tttaattcagatattatcggctaataaatatacaagaccatacttatctcataactttta
taataaaaaaatttaacaggaggaaatactatgaaaaaatcaatattaattttaacctta
tgcacaacagtatcttttatgtccttagctgaaaataattatgcagttaaaatagctaaa
aagacagtgcctactgctacacaaaaagcagtaacctatgattcgccggaagaaataata
gaaagaatacaacaagaaataaaacacaaataaatataatatttaggaggaaatactatg
aaaaagacaatcttattttttactttattaactttagtttcttcagcttttgcagccgaa
actatgataaatcttaaatttactggacaaacacaatcaaaagaaactacaaaagatgaa
agattag


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search