The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|526218.6.peg.1353: Sebaldella termitidis ATCC 33386

This feature in The SEED Viewer

NCBI Taxonomy Id: 526218

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NC_013517 from base 1412744 to 1423335 (10592 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1348 1412744 1414306 1563 +           TPR domain protein locus|Sterm_1318, protein_id|YP_003308115.1, gi|269119938, InterPro:IPR001440, InterPro:IPR006597, InterPro:IPR013026, InterPro:IPR013105, geneID|8596795
1349 1414401 1414565 165 + 94     1: 1   hypothetical protein locus|Sterm_1319, protein_id|YP_003308116.1, gi|269119939, geneID|8596796
1350 1414526 1414987 462 + -40     1: 1   hypothetical protein locus|Sterm_1320, protein_id|YP_003308117.1, gi|269119940, geneID|8596797
1351 1416681 1416136 546 - 1148         TPR domain protein locus|Sterm_1321, protein_id|YP_003308118.1, gi|269119941, InterPro:IPR001440, InterPro:IPR006597, InterPro:IPR011716, InterPro:IPR013026, geneID|8596798
1352 1417489 1416779 711 - 97         Phage antirepressor protein locus|Sterm_1322, protein_id|YP_003308119.1, gi|269119942, InterPro:IPR003497, geneID|8596799
1353 1418465 1417974 492 - 484     1: 1   hypothetical protein locus|Sterm_1324, protein_id|YP_003308121.1, gi|269119944, geneID|8596801
1354 1418855 1418565 291 - 99     1: 1   hypothetical protein locus|Sterm_1325, protein_id|YP_003308122.1, gi|269119945, geneID|8596802
1355 1419169 1418873 297 - 17     1: 1   hypothetical protein locus|Sterm_1326, protein_id|YP_003308123.1, gi|269119946, InterPro:IPR002048, geneID|8596803
1356 1419915 1419265 651 - 95     1: 1   hypothetical protein locus|Sterm_1327, protein_id|YP_003308124.1, gi|269119947, geneID|8596804
1357 1420482 1419916 567 - 0     1: 1   hypothetical protein locus|Sterm_1328, protein_id|YP_003308125.1, gi|269119948, geneID|8596805
1358 1420586 1420948 363 + 103     4: 3 5 7 2   Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake  
1359 1421255 1422157 903 + 306     2: 6 4   Oxidoreductase locus|Sterm_1330, protein_id|YP_003308126.1, gi|269119949, InterPro:IPR001395, geneID|8599616
1360 1422356 1422832 477 + 198         Auxin-binding protein, putative locus|Sterm_1331, protein_id|YP_003308127.1, gi|269119950, InterPro:IPR006045, InterPro:IPR013096, geneID|8596807
1361 1423128 1422967 162 - 134     1: 1   hypothetical protein locus|Sterm_1332, protein_id|YP_003308128.1, gi|269119951, geneID|8596808
1362 1423335 1423153 183 - 24     1: 1   hypothetical protein locus|Sterm_1333, protein_id|YP_003308129.1, gi|269119952, geneID|8596809

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
DHQS_phosphatase_fusion Thamm_Antje_user hypothetical protein


  Protein Sequence

>fig|526218.6.peg.1353 hypothetical protein
MNESVDKIIRKITGELRIIIEKESGRDKEYSELLLDYIAKMNENIQKKNFDNSQIEEYIS
KIKGNYLHSEKSPYLGEYAQELIDVLSASLINVKINLEELMEKHNIKSVSSLERQLKMKN
LYISRQTLQRLSQNIGVEKMNLSTIIKLKKFFNCSLDDLFTIT

MD5 = 94735188bba331bf46941ec9610f2c33


  DNA Sequence

>fig|526218.6.peg.1353 hypothetical protein
atgaatgaatcagtagataaaattataagaaaaattactggagaattgcgtataattata
gaaaaagaatctggtcgtgataaagaatattctgaactattattagattatatagcaaaa
atgaatgaaaatattcaaaaaaagaatttcgataacagtcaaattgaagaatatataagt
aaaataaaaggaaattatcttcattctgaaaagtcaccttatttaggtgaatatgctcaa
gaattaattgatgttcttagtgcatcactaataaatgtaaaaatcaatttagaagaactt
atggaaaaacataatataaaaagtgtttcttctttagaacgacaattaaaaatgaaaaat
ttatatatttccagacaaactctacagagactttctcagaatattggagttgaaaagatg
aatttatcaactatcattaaattaaaaaaatttttcaattgtagcttagatgatttattt
actataacttga


  DNA with Flanking Sequence

>fig|526218.6.peg.1353 hypothetical protein
actactctggaaattatgatacaatttaacgatgacattaataatgataaatttattcaa
cttgaagaactttatcagaattttttggaataatcaaatggagggaaaatatgaattgga
ttcctatttcacaattaagtgatgatgctaaaatctggtctggaataattgtaaaattat
acaatgttggcttgaatgtttcagataaatctaaagattattatgaatatctgatatcag
agatttacggtaacaatgaatatttgcagcttacatgtctttcacaaggagaagccggaa
acataatatgtgttttaaagaaagacctgcctaactattatgctttaggtaaagaattaa
aaagaatgatgaagatagaagatagaagatacttttattaatattgattctatataaaat
acttatcttgcatttatacaaaaaatgacttaaaatatacaagagtatatatacttgaaa
gttaggagtaatgaatccatatgaatgaatcagtagataaaattataagaaaaattactg
gagaattgcgtataattatagaaaaagaatctggtcgtgataaagaatattctgaactat
tattagattatatagcaaaaatgaatgaaaatattcaaaaaaagaatttcgataacagtc
aaattgaagaatatataagtaaaataaaaggaaattatcttcattctgaaaagtcacctt
atttaggtgaatatgctcaagaattaattgatgttcttagtgcatcactaataaatgtaa
aaatcaatttagaagaacttatggaaaaacataatataaaaagtgtttcttctttagaac
gacaattaaaaatgaaaaatttatatatttccagacaaactctacagagactttctcaga
atattggagttgaaaagatgaatttatcaactatcattaaattaaaaaaatttttcaatt
gtagcttagatgatttatttactataacttgaggccatttcatggtctctttttttcaaa
aaatacgtaaatacatttgacaaaaaagtaaatatgttatatattattattagaaataaa
aatagccaactgttgaagcagctgactattataaaggatacttgttataagtacccccga
atatgtacattataacaaatatcctaaaaaaatacaattttttaggaggaatcactatga
atcaaaacattaaagaatttatgatctctcacattgaagagatgtatgattacggtcatt
taaaagacgacctgtctaaaatggaagataacttttataacttaattgaaaacatcaatt
ctaaaactacatgtactaaaaatgacatccaacagcttattaacacttttgaaactgtat
tattaaccgcaaagaaaacctattttgaacacggagctacttctggaatatctaatatca
acaaaatgtatttaactccaaatgaggtggtacttcatggataaacttcaaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|526218.4.peg.2558 Sebaldella termitidis ATCC 33386 FIG   hypothetical protein
gb|EEP36187.1 Sebaldella termitidis ATCC 33386     hypothetical protein StermDRAFT_15410
gi|229800148 Sebaldella termitidis ATCC 33386 NCBI   hypothetical protein StermDRAFT_15410
gi|229882589 Sebaldella termitidis ATCC 33386 NCBI   hypothetical protein StermDRAFT_15410
ref|ZP_04502063.1 Sebaldella termitidis ATCC 33386 RefSeq   hypothetical protein StermDRAFT_15410
tr|C4BZG2 Sebaldella termitidis ATCC 33386 TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search