The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|526218.6.peg.1352: Sebaldella termitidis ATCC 33386

This feature in The SEED Viewer

NCBI Taxonomy Id: 526218

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig NC_013517 from base 1411651 to 1422832 (11182 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1346 1411651 1412295 645 +           Helix-turn-helix motif locus|Sterm_1316, protein_id|YP_003308113.1, gi|269119936, InterPro:IPR001387, geneID|8596793
1347 1412314 1412721 408 + 18     1: 1   hypothetical protein locus|Sterm_1317, protein_id|YP_003308114.1, gi|269119937, InterPro:IPR001440, InterPro:IPR013026, geneID|8596794
1348 1412744 1414306 1563 + 22         TPR domain protein locus|Sterm_1318, protein_id|YP_003308115.1, gi|269119938, InterPro:IPR001440, InterPro:IPR006597, InterPro:IPR013026, InterPro:IPR013105, geneID|8596795
1349 1414401 1414565 165 + 94     1: 1   hypothetical protein locus|Sterm_1319, protein_id|YP_003308116.1, gi|269119939, geneID|8596796
1350 1414526 1414987 462 + -40     1: 1   hypothetical protein locus|Sterm_1320, protein_id|YP_003308117.1, gi|269119940, geneID|8596797
1351 1416681 1416136 546 - 1148         TPR domain protein locus|Sterm_1321, protein_id|YP_003308118.1, gi|269119941, InterPro:IPR001440, InterPro:IPR006597, InterPro:IPR011716, InterPro:IPR013026, geneID|8596798
1352 1417489 1416779 711 - 97         Phage antirepressor protein locus|Sterm_1322, protein_id|YP_003308119.1, gi|269119942, InterPro:IPR003497, geneID|8596799
1353 1418465 1417974 492 - 484     1: 1   hypothetical protein locus|Sterm_1324, protein_id|YP_003308121.1, gi|269119944, geneID|8596801
1354 1418855 1418565 291 - 99     1: 1   hypothetical protein locus|Sterm_1325, protein_id|YP_003308122.1, gi|269119945, geneID|8596802
1355 1419169 1418873 297 - 17     1: 1   hypothetical protein locus|Sterm_1326, protein_id|YP_003308123.1, gi|269119946, InterPro:IPR002048, geneID|8596803
1356 1419915 1419265 651 - 95     1: 1   hypothetical protein locus|Sterm_1327, protein_id|YP_003308124.1, gi|269119947, geneID|8596804
1357 1420482 1419916 567 - 0     1: 1   hypothetical protein locus|Sterm_1328, protein_id|YP_003308125.1, gi|269119948, geneID|8596805
1358 1420586 1420948 363 + 103     4: 3 5 7 2   Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake  
1359 1421255 1422157 903 + 306     2: 6 4   Oxidoreductase locus|Sterm_1330, protein_id|YP_003308126.1, gi|269119949, InterPro:IPR001395, geneID|8599616
1360 1422356 1422832 477 + 198         Auxin-binding protein, putative locus|Sterm_1331, protein_id|YP_003308127.1, gi|269119950, InterPro:IPR006045, InterPro:IPR013096, geneID|8596807

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|526218.6.peg.1352 Phage antirepressor protein
MDKLQIFQSKEFGKVRTVLIENEVWFVLIDICKILELSNPSSVIKRLDEDEVTKFDLGSL
SGITNIINESGLYKVIFRSDKPQANQFTKWVTHDVLPSLRKTGSYSINQTPKELELKEKE
IQLKTAEFLNNMADSILIPEYKQILNAHATKVLTGDFLLPLPVVGEITYSATEIGKMLNI
SANMVGRLTKKHNLRTEEYGKVFYDKSKYSSKEVETFRYYIKVIDILKNIVSTLSA

MD5 = 6b5a8584d7dc4adfbebae2d8bde4ed97


  DNA Sequence

>fig|526218.6.peg.1352 Phage antirepressor protein
atggataaacttcaaatatttcaaagtaaagaatttggaaaagtaagaactgtattgata
gaaaatgaagtctggtttgtattaattgatatatgtaagatattagaactttcaaatcca
agtagtgtgatcaaaagattagatgaggacgaggtgactaagtttgacttagggagctta
tcagggattaccaatatcattaatgaaagcggattatataaagtaatttttagaagtgac
aaacctcaagctaatcaatttactaaatgggtaacccatgatgtattaccttcactaaga
aaaactggcagctactcaataaaccaaacaccaaaagaacttgaactaaaagaaaaagaa
atccaacttaaaactgctgaatttcttaataatatggctgacagtattctgattcctgaa
tacaagcagatacttaatgctcatgctactaaggtactaaccggggattttctacttcca
ttacctgttgttggtgaaataacctatagtgctactgaaattggcaaaatgcttaatatc
tcagctaatatggttggaagattaactaaaaagcataatctccgtactgaagaatatgga
aaagtcttttatgacaagtctaagtattccagtaaggaagttgagactttcaggtattat
attaaggttattgatattttaaagaatattgttagcactctatccgcataa


  DNA with Flanking Sequence

>fig|526218.6.peg.1352 Phage antirepressor protein
atttactataacttgaggccatttcatggtctctttttttcaaaaaatacgtaaatacat
ttgacaaaaaagtaaatatgttatatattattattagaaataaaaatagccaactgttga
agcagctgactattataaaggatacttgttataagtacccccgaatatgtacattataac
aaatatcctaaaaaaatacaattttttaggaggaatcactatgaatcaaaacattaaaga
atttatgatctctcacattgaagagatgtatgattacggtcatttaaaagacgacctgtc
taaaatggaagataacttttataacttaattgaaaacatcaattctaaaactacatgtac
taaaaatgacatccaacagcttattaacacttttgaaactgtattattaaccgcaaagaa
aacctattttgaacacggagctacttctggaatatctaatatcaacaaaatgtatttaac
tccaaatgaggtggtacttcatggataaacttcaaatatttcaaagtaaagaatttggaa
aagtaagaactgtattgatagaaaatgaagtctggtttgtattaattgatatatgtaaga
tattagaactttcaaatccaagtagtgtgatcaaaagattagatgaggacgaggtgacta
agtttgacttagggagcttatcagggattaccaatatcattaatgaaagcggattatata
aagtaatttttagaagtgacaaacctcaagctaatcaatttactaaatgggtaacccatg
atgtattaccttcactaagaaaaactggcagctactcaataaaccaaacaccaaaagaac
ttgaactaaaagaaaaagaaatccaacttaaaactgctgaatttcttaataatatggctg
acagtattctgattcctgaatacaagcagatacttaatgctcatgctactaaggtactaa
ccggggattttctacttccattacctgttgttggtgaaataacctatagtgctactgaaa
ttggcaaaatgcttaatatctcagctaatatggttggaagattaactaaaaagcataatc
tccgtactgaagaatatggaaaagtcttttatgacaagtctaagtattccagtaaggaag
ttgagactttcaggtattatattaaggttattgatattttaaagaatattgttagcactc
tatccgcataaagaaaaatctctatataaaaatttttataaattatttgtttgatttttt
ataatttagctgttacaatttttcatatcttaactactggaggaactaatgattaaaaaa
atattcgttactttcattatctttggtgtattttattcttgctctccttcaaatcctgaa
ccaactgtaggaactgaagaatattatcttgaaaaaataaaaattgaagatcgagaatct
atgtttcaattaggtcttttatatcaagaacaaggaaaattcgaacttgctgaaaaatac
tatcttatggctagcgaacatagtgactctaatgctatgaacaatttaggaaatctatat
aaaaaacaagagaaatttgaacttgcagaaaggctctttctcatggccattaaatacgat
aataaattagccttatataatttaggacttttatatcatgatcaagaaaaattcaaactt
gctgaaaaatactatcttatggctattgaaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|526218.4.peg.2557 Sebaldella termitidis ATCC 33386 FIG   Phage antirepressor protein
gb|EEP36185.1 Sebaldella termitidis ATCC 33386     prophage antirepressor
gi|229800146 Sebaldella termitidis ATCC 33386 NCBI   prophage antirepressor
gi|229882587 Sebaldella termitidis ATCC 33386 NCBI   prophage antirepressor
ref|ZP_04502061.1 Sebaldella termitidis ATCC 33386 RefSeq   prophage antirepressor
tr|C4BZG0 Sebaldella termitidis ATCC 33386 TrEMBL   Prophage antirepressor


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


Tool Description
General Tools
Psi-Blast NCBI's psi-blast is used to locate distant similarities
Transmembrane Predictions
TMpred Tool for Predicting Transmembrane regions
TMHMM Prediction of transmembrane helices in proteins
Protein Signals for Gram negative bacteria
Gram negative PSORT Prediction of protein localization sites
Gram negative SignalP Predicts the presence and location of signal peptide cleavage sites
Protein Signals for Gram positive bacteria
Gram positive PSORT Prediction of protein localization sites
Gram positive SignalP Predicts the presence and location of signal peptide cleavage sites
Other useful tools
LipoP Prediction of lipoproteins and signal peptides in Gram negative bacteria
Radar Rapid Automatic Detection and Alignment of Repeats in protein sequences
PPSearch Search for protein motifs against all patterns stored in the PROSITE pattern database
Gram negative CELLO Subcellular localization predictor at National Chiao Tung University
Gram positive CELLO Subcellular localization predictor at National Chiao Tung University
ProDom A comprehensive set of protein domain families automatically generated from the SWISS-PROT and TrEMBL sequence databases
PDB An Information Portal to Biological Macromolecular Structures
For Specific Organisms
RNAFold The RNAfold web server will predict secondary structures of single stranded RNA or DNA sequences.

< Hide tool descriptions


FIG search