The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|526218.6.peg.1350: Sebaldella termitidis ATCC 33386

This feature in The SEED Viewer

NCBI Taxonomy Id: 526218

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NC_013517 from base 1409638 to 1420482 (10845 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1343 1409638 1410012 375 +       1: 1   hypothetical protein locus|Sterm_1313, protein_id|YP_003308110.1, gi|269119933, geneID|8596790
1344 1410614 1410438 177 - 425     1: 1   hypothetical protein locus|Sterm_1314, protein_id|YP_003308111.1, gi|269119934, geneID|8596791
1345 1411254 1411610 357 + 639     1: 1   hypothetical protein locus|Sterm_1315, protein_id|YP_003308112.1, gi|269119935, geneID|8596792
1346 1411651 1412295 645 + 40         Helix-turn-helix motif locus|Sterm_1316, protein_id|YP_003308113.1, gi|269119936, InterPro:IPR001387, geneID|8596793
1347 1412314 1412721 408 + 18     1: 1   hypothetical protein locus|Sterm_1317, protein_id|YP_003308114.1, gi|269119937, InterPro:IPR001440, InterPro:IPR013026, geneID|8596794
1348 1412744 1414306 1563 + 22         TPR domain protein locus|Sterm_1318, protein_id|YP_003308115.1, gi|269119938, InterPro:IPR001440, InterPro:IPR006597, InterPro:IPR013026, InterPro:IPR013105, geneID|8596795
1349 1414401 1414565 165 + 94     1: 1   hypothetical protein locus|Sterm_1319, protein_id|YP_003308116.1, gi|269119939, geneID|8596796
1350 1414526 1414987 462 + -40     1: 1   hypothetical protein locus|Sterm_1320, protein_id|YP_003308117.1, gi|269119940, geneID|8596797
1351 1416681 1416136 546 - 1148         TPR domain protein locus|Sterm_1321, protein_id|YP_003308118.1, gi|269119941, InterPro:IPR001440, InterPro:IPR006597, InterPro:IPR011716, InterPro:IPR013026, geneID|8596798
1352 1417489 1416779 711 - 97         Phage antirepressor protein locus|Sterm_1322, protein_id|YP_003308119.1, gi|269119942, InterPro:IPR003497, geneID|8596799
1353 1418465 1417974 492 - 484     1: 1   hypothetical protein locus|Sterm_1324, protein_id|YP_003308121.1, gi|269119944, geneID|8596801
1354 1418855 1418565 291 - 99     1: 1   hypothetical protein locus|Sterm_1325, protein_id|YP_003308122.1, gi|269119945, geneID|8596802
1355 1419169 1418873 297 - 17     1: 1   hypothetical protein locus|Sterm_1326, protein_id|YP_003308123.1, gi|269119946, InterPro:IPR002048, geneID|8596803
1356 1419915 1419265 651 - 95     1: 1   hypothetical protein locus|Sterm_1327, protein_id|YP_003308124.1, gi|269119947, geneID|8596804
1357 1420482 1419916 567 - 0     1: 1   hypothetical protein locus|Sterm_1328, protein_id|YP_003308125.1, gi|269119948, geneID|8596805

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
DHQS_phosphatase_fusion Thamm_Antje_user hypothetical protein


  Protein Sequence

>fig|526218.6.peg.1350 hypothetical protein
MENNRQAIIGYCLELGTVVPDVIDSSCTMVKTSGADKQLEFLNKNAQLIKAKSVSEAVEV
LQAEYNAMEKEVIFFDGIETIKFVVDKANLIPVVPENELKLLKIMNLSYMLGLDLSLGTN
YMEKTGEILLNDDIEYQRTKYRSLKALSESSGK

MD5 = 4ed10a41493cff5713458cd847ea769b


  DNA Sequence

>fig|526218.6.peg.1350 hypothetical protein
ttggaaaataaccgacaagctattattggatattgtttagaattgggaactgtagtccct
gatgtgatagattcgagttgcacaatggtaaaaacaagtggagctgataagcagttagaa
tttttaaataaaaatgctcagttaataaaagcaaaaagtgtgagtgaagctgtagaagta
ttacaagcggagtataatgcaatggaaaaggaagttatattttttgatgggatagaaacg
ataaaatttgtagtagataaagcgaacttaataccagttgttcctgaaaatgagttaaaa
ctcttgaaaataatgaatttaagttatatgttaggtttagatttatctttagggactaat
tatatggaaaaaacaggagaaatattgttgaatgatgatattgaataccagagaactaag
tacagaagtctaaaagcattaagtgaatcttcaggaaaataa


  DNA with Flanking Sequence

>fig|526218.6.peg.1350 hypothetical protein
ttattcctgaaattttaatgcctttaaggtacttaattaaagatccggcatatgaagaag
aaagagagtgtaggattataaaaatactaaaatttggaaatgaagaaataatagaagata
atgaattaaaaagaatctacagcgaatataaagtaaatatagaagatcatattgcttaca
taaacatacatcaaaggcaagaactatatacgacattttttcaaaataaattaaaagata
gaaataaagtaaaaatatcaaagaatcctttcaatggctaatgtaaatgattgtaaataa
tatgttaaaatggtggagttacctcaaagaagtatacctgaagttaagatagtgagaaaa
aattgaggaaggttcatggtggaaaaaatattaattatattgattttatgtttagggacg
ttgggctgtgatgcaatgcttagtgaagctgacaagcagttaaaagtaatagagaaatta
gaaaaaatattccagaagagttggaaaataaccgacaagctattattggatattgtttag
aattgggaactgtagtccctgatgtgatagattcgagttgcacaatggtaaaaacaagtg
gagctgataagcagttagaatttttaaataaaaatgctcagttaataaaagcaaaaagtg
tgagtgaagctgtagaagtattacaagcggagtataatgcaatggaaaaggaagttatat
tttttgatgggatagaaacgataaaatttgtagtagataaagcgaacttaataccagttg
ttcctgaaaatgagttaaaactcttgaaaataatgaatttaagttatatgttaggtttag
atttatctttagggactaattatatggaaaaaacaggagaaatattgttgaatgatgata
ttgaataccagagaactaagtacagaagtctaaaagcattaagtgaatcttcaggaaaat
aataatgatgaaaattggcagttagttatatttgttaaaataaggtaaatatcaaaattt
atattgagaattatactaaaataaagccctccaaagagggccttttattatgcggataga
gtgcttacaataatataaataaacatatttttaaaaacttgcactttttcggaaatatga
tataataatattgaaaacgagtataaagatttaaaattttgtgacaattaagctagacgt
gagtctggcttttttgttataataatttgtggtttcacaaaaaccataaatctttatact
cggaggacatctatgcgtacattagcaatagttactatattatttatagtaattactaaa
gtactgtattaacagttcctcagcccctttggggctttttttaattctataatttctgtc
gacctccattaaggtaaaaactataggagatcgacaactttaagtagaacaatgctttga
tagcattttctcataaaatgag


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search