The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|525919.6.peg.59: Anaerococcus prevotii DSM 20548

This feature in The SEED Viewer

NCBI Taxonomy Id: 525919

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig NC_013164 from base 59104 to 70128 (11025 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
52 59104 59691 588 +           AbiEi antitoxin, Type IV TA system locus|Apre_1797, protein_id|YP_003142373.1, gi|256821174, geneID|8368766
53 59838 60440 603 + 146         Transcriptional regulator, AraC family locus|Apre_1798, protein_id|YP_003142374.1, gi|256821175, InterPro:IPR000005, geneID|8368707
54 60592 60828 237 + 151         regulatory protein C.BcnI locus|Apre_1799, protein_id|YP_003142375.1, gi|256821176, InterPro:IPR001387, geneID|8368708
55 60831 61949 1119 + 2     3: 1 3 2   Type I restriction-modification system, DNA-methyltransferase subunit M (EC 2.1.1.72) locus|Apre_1800, protein_id|YP_003142376.1, gi|256821177, geneID|8368709
56 62107 62880 774 + 157         replication initiator protein A locus|Apre_1801, protein_id|YP_003142377.1, gi|256821178, InterPro:IPR010724, geneID|8368710
57 62877 63704 828 + -4         Phage DNA helicase loader locus|Apre_1802, protein_id|YP_003142378.1, gi|256821179, InterPro:IPR003593, geneID|8368711
58 63697 64182 486 + -8         DUF3801 protein locus|Apre_1803, protein_id|YP_003142379.1, gi|256821180, geneID|8368712
59 64179 64913 735 + -4         Phage antirepressor protein locus|Apre_1804, protein_id|YP_003142380.1, gi|256821181, InterPro:IPR003497, InterPro:IPR005039, geneID|8368713
60 64906 66702 1797 + -8         hypothetical protein locus|Apre_1805, protein_id|YP_003142381.1, gi|256821182, InterPro:IPR003688, geneID|8368714
61 66721 66996 276 + 18         FIG01196643: hypothetical protein locus|Apre_1806, protein_id|YP_003142382.1, gi|256821183, geneID|8368715
62 67240 67464 225 + 243         hypothetical protein  
63 67517 67897 381 + 52         hypothetical protein locus|Apre_1808, protein_id|YP_003142383.1, gi|256821184, geneID|8368767
64 68426 68737 312 + 528         hypothetical protein locus|Apre_1810, protein_id|YP_003142385.1, gi|256821186, InterPro:IPR000424, geneID|8368718
65 68739 68954 216 + 1         Maff2 family protein # long form locus|Apre_1811, protein_id|YP_003142386.1, gi|256821187, geneID|8368719
66 68965 69828 864 + 10         FIG01118304: hypothetical protein locus|Apre_1812, protein_id|YP_003142387.1, gi|256821188, geneID|8368720
67 69838 70128 291 + 9         FIG01116872: hypothetical protein locus|Apre_1813, protein_id|YP_003142388.1, gi|256821189, geneID|8368721

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|525919.6.peg.59 Phage antirepressor protein
MISNLKTFENKNFGKLTVIEKDGEFFFIANEVATMLGYVNPRKAVYDHVDEEDKGVTKWN
TPGGIQNISIINESGLYSLILSSKLPQAKIFKAWVTREVLPSIRKNGGYIVGQEKKTNEE
LLADAILVANRIIAEREEEIVELRPKADYYDKLVDYNLLTNFRNTAKELGIPQNQFISFL
MDKGLIYRDKKKKLLPYADKNKGYFEVKEWVDPLGTLVGIQTFITQKGRHYLLILLDSEG
FYDE

MD5 = 098a6f0c604646d52822a95d54ee7c37


  DNA Sequence

>fig|525919.6.peg.59 Phage antirepressor protein
atgataagtaatttaaaaacatttgaaaataagaattttgggaaactcactgttatagaa
aaagacggtgagtttttctttatagcaaatgaagtagcaactatgctaggatatgtcaat
ccaagaaaagctgtttatgaccatgtagatgaagaagataagggtgtaacgaaatggaac
acccctggaggaatacagaatatttcaataattaacgaatcaggattgtattcacttatc
ctttcatcaaaactaccacaagcaaaaatattcaaagcttgggtaactagagaagtctta
ccaagtattagaaaaaatggaggatatatagtagggcaagaaaagaaaactaatgaagag
ttacttgcagatgcaattcttgtagccaatagaattattgctgaaagagaagaagaaatt
gtagaattaagaccaaaggcagactattatgacaaattagtagattataacctacttaca
aactttagaaatactgccaaagagttaggaataccacaaaatcaatttataagtttttta
atggataagggattaatttatagagataagaaaaagaaacttctaccttatgcagataag
aacaagggatattttgaggtcaaagaatgggttgatccactaggtacacttgtaggaata
caaacatttataacacaaaagggaagacactacctactaattttattagatagtgaaggt
ttctacgatgaataa


  DNA with Flanking Sequence

>fig|525919.6.peg.59 Phage antirepressor protein
tatatggaggtggaatagatgattaatgaagaagtatctaggtcgagccttaaccttgaa
gtaaggcttgcaaaagcaacaagtaaagcaattcttgatgccttaaagaaagtacacaag
caaatagaagaacaaggaggcttgaaaaatgtaataaaaaataacggagaagaagtaaaa
ctaaaggatatggttaaaaagggacagttagaagaaattaatctaaaagatcctgagtta
aaagaactaaagaaaattttaaataagcacggagtgaagttttctgttatgaaagataaa
gaaactggtaaccactctgtgttttttcaatctaaggatataaaggtaatggaacacgcc
tttaaaaaagcagtcaaggtttctgaaagaaaggtcgatagaaaagattcaataacgaag
acaataaataagtttaaagatatggctaaggacaccattactaaagataaagttaaaaat
aaacataaggagcaaagcttatgataagtaatttaaaaacatttgaaaataagaattttg
ggaaactcactgttatagaaaaagacggtgagtttttctttatagcaaatgaagtagcaa
ctatgctaggatatgtcaatccaagaaaagctgtttatgaccatgtagatgaagaagata
agggtgtaacgaaatggaacacccctggaggaatacagaatatttcaataattaacgaat
caggattgtattcacttatcctttcatcaaaactaccacaagcaaaaatattcaaagctt
gggtaactagagaagtcttaccaagtattagaaaaaatggaggatatatagtagggcaag
aaaagaaaactaatgaagagttacttgcagatgcaattcttgtagccaatagaattattg
ctgaaagagaagaagaaattgtagaattaagaccaaaggcagactattatgacaaattag
tagattataacctacttacaaactttagaaatactgccaaagagttaggaataccacaaa
atcaatttataagttttttaatggataagggattaatttatagagataagaaaaagaaac
ttctaccttatgcagataagaacaagggatattttgaggtcaaagaatgggttgatccac
taggtacacttgtaggaatacaaacatttataacacaaaagggaagacactacctactaa
ttttattagatagtgaaggtttctacgatgaataagatattagaagccattctttctgat
attaaaaacttaattaaaatagacaacccaaagaaatttatattagcaaacattccttat
ttatcatttttttatattggaaatatcttttctaagcacatcaattcttatgttggagga
gatataattgacagaataatggtgggaatttctgatataggaactttatcttatatacca
agccttaatccaagggacttgttagtaggtatttcagttgctgccattgttaagctaata
gtatatagtaaaggtaaaaacaaaaagaaatataggcaaggtaaggaatatggatctgca
agatggggagaaagcaaggatattgctccatatatagaccctaagtttgaaaacaatgta
ctaataactaataccgaaagactaacaatgaactcaagacctaagaaccctaagtatgct
agaaataaaaatgtattagtaataggtggttctggatcaggtaagacaagatttt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
fig|525919.4.peg.1594 Anaerococcus prevoti prevotii DSM 20548 FIG   Phage antirepressor protein
gb|ACV29815.1 Anaerococcus prevotii DSM 20548     prophage antirepressor
gi|256799161 Anaerococcus prevotii DSM 20548 NCBI   prophage antirepressor
gi|256821181 Anaerococcus prevotii DSM 20548 NCBI   prophage antirepressor
kegg|apr:Apre_1804 Anaerococcus prevotii DSM 20548 KEGG   prophage antirepressor
ref|YP_003142380.1 Anaerococcus prevotii DSM 20548 RefSeq   prophage antirepressor
tr|C1Q2L5 Anaerococcus prevotii DSM 20548 TrEMBL   Prophage antirepressor


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search