The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|525368.3.peg.2091: Mycobacterium parascrofulaceum ATCC BAA-614

This feature in The SEED Viewer

NCBI Taxonomy Id: 525368

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NZ_GG770554 from base 417347 to 428237 (10891 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2081 417347 417928 582 +       2: 6 7   Molybdenum ABC transporter, periplasmic molybdenum-binding protein ModA (TC 3.A.1.8.1)  
2082 418600 418169 432 - 240         hypothetical protein  
2083 419717 418746 972 - 145         hypothetical protein  
2084 420604 419714 891 - -4         hypothetical protein  
2085 420720 420601 120 - -4         hypothetical protein  
2086 420866 420717 150 - -4         hypothetical protein  
2087 421210 420863 348 - -4         hypothetical protein  
2088 421613 421296 318 - 85         FIG00828517: hypothetical protein  
2089 421920 421675 246 - 61         hypothetical protein  
2090 422075 421917 159 - -4         FIG00828814: hypothetical protein  
2091 422863 422072 792 - -4         hypothetical protein  
2092 422962 423261 300 + 98         hypothetical protein  
2093 423449 423327 123 - 65         hypothetical protein  
2094 424182 424355 174 + 732     6: 10 8 9 1 4 3   LSU ribosomal protein L32p @ LSU ribosomal protein L32p, zinc-independent  
2095 424422 425111 690 + 66     2: 2 1   Mycobacterial persistence regulator MprA (Two component response transcriptional regulatory protein)  
2096 425128 426672 1545 + 16     3: 5 2 1   Signal transduction histidine-protein kinase/phosphatase MprB (EC 2.7.13.3) (EC 3.1.3.-)  
2097 427064 426681 384 - 8         hypothetical protein  
2098 427101 428237 1137 + 36     1: 1   HtrA protease/chaperone family protein, Rv0983 homolog  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|525368.3.peg.2091 hypothetical protein
MSAVELFTYEETAQIRTVTIDERRWAVAADICAAIDIRDVSAAIAKLDQRDKMVIRRSDT
PGSNQGIWQQISPRVQSIGLVSEDGATDLVLESRKPEARRFRRFLTHEVWPAIRDTGSYS
TVPTLTDDELIHRALEVSARRVAELTERVAELEPQAAVATKLLDAEGDLSVRDAATSLTR
AGIKIGAGRLFAELERRGWIKRALGDGRYRVMQKAIETGYMSVLPQSHYHPKTGVLVLDP
PQPRVTPKGLQRLLGDYDKGGSR

MD5 = 6a94fa068a8df97bcb884683be041d46


  DNA Sequence

>fig|525368.3.peg.2091 hypothetical protein
gtgagcgccgtcgagctgttcacctacgaagagaccgcccagatccggaccgtcaccatc
gacgagcgccggtgggctgtcgccgccgacatctgcgccgcgatcgacatcagggacgtc
tccgctgcgatagcgaagctggaccagcgggacaagatggttatccgcaggtcagatact
ccgggttcaaaccagggtatctggcagcaaatctcaccccgagttcagtcgatcggcctt
gtctccgaagacggcgcgactgacctcgtgctcgagtcacgcaagcccgaggcccgcagg
ttccgccgattcttgacccatgaggtatggccggcgatccgcgacaccggctcctactcc
accgtccccacgctcaccgacgacgaactgatccaccgcgcgctcgaagtcagcgcgcgc
cgcgtcgccgagctgaccgaacgcgtggccgaactcgaaccccaagccgcggtggcgacg
aagctcctcgacgctgaaggcgacctgtctgtgcgcgacgccgcgacgtcacttacccgt
gccggcatcaagattggcgctggccgattgttcgccgaactggaacgccgaggctggatc
aaacgcgccctcggcgacggccggtaccgcgtcatgcagaaggcgatcgaaaccggctac
atgtcagtgctgcctcagtctcactatcacccgaagacgggcgtcctggtccttgatccg
ccgcagccacgtgtgactcccaagggcttgcagcggttactcggcgactacgacaagggc
ggtagtcggtga


  DNA with Flanking Sequence

>fig|525368.3.peg.2091 hypothetical protein
cgcgttctccgggaccgcagccaaggacgcgtcgtgagcgggctctctggccttcccgag
ctgctcaccgaggaccgggtccgggaggtcgtgcgcgaggagttagccgcccacgccgaa
ctcgcccatgatcgcgtccaacgtggactcggggagcccggggcgcccggccagctgttc
gagccggttctccaaagtgatgacgcagaccgtcagagttgccgcgagcgtttcgatgtt
ctgcgagagcttttcgagggatgtttcaccgtcatcctcagcgacggggcgcagggcggc
gaacagattcagaacgccgtgagtcgctggcatcgtttccgggacatggttcgtgagggc
ccggattccgtctcgggcttcgtcgggggtggggacgaccatgatgcttctccttcgctg
gttggtgacacaggaagcgtaggagacgggccgggcccggccgatgaaaccgggcccggc
cacaccccgggcggtacacggtgagcgccgtcgagctgttcacctacgaagagaccgccc
agatccggaccgtcaccatcgacgagcgccggtgggctgtcgccgccgacatctgcgccg
cgatcgacatcagggacgtctccgctgcgatagcgaagctggaccagcgggacaagatgg
ttatccgcaggtcagatactccgggttcaaaccagggtatctggcagcaaatctcacccc
gagttcagtcgatcggccttgtctccgaagacggcgcgactgacctcgtgctcgagtcac
gcaagcccgaggcccgcaggttccgccgattcttgacccatgaggtatggccggcgatcc
gcgacaccggctcctactccaccgtccccacgctcaccgacgacgaactgatccaccgcg
cgctcgaagtcagcgcgcgccgcgtcgccgagctgaccgaacgcgtggccgaactcgaac
cccaagccgcggtggcgacgaagctcctcgacgctgaaggcgacctgtctgtgcgcgacg
ccgcgacgtcacttacccgtgccggcatcaagattggcgctggccgattgttcgccgaac
tggaacgccgaggctggatcaaacgcgccctcggcgacggccggtaccgcgtcatgcaga
aggcgatcgaaaccggctacatgtcagtgctgcctcagtctcactatcacccgaagacgg
gcgtcctggtccttgatccgccgcagccacgtgtgactcccaagggcttgcagcggttac
tcggcgactacgacaagggcggtagtcggtgagcgcggccgtcaccttcggcgggatctg
cgaccgctgcctcaaaccgttccacacaccgcggttcccgaatgactgcctgtgccgcgc
ctgccacctgggcgccctgtcgccggtcgaacgcgcggtcgcgctcgtgagtggagcggt
gtcgtgatcaacgcgttgcggacgctcgccgccgctggcttcgacgccctcgcgcacatc
gcctatccggccgctgacgcgatctgggaggagcgccgccggcgccccgacgctgaactg
atcctgctcgacgagatgtctgatcacctcggcgtgatccgggcgcagctcgaagacgtc
cggaacctgctgcaacagcagaactcgttggcgctcggcctgcccggcctcccgcgccac
accaaatagaagcggcccgcgccggaagacagccagcgcgggccaaacccacggaaagga
accaatccctgtgagtgcaccgattctaaccggccccaaacgaatcctgcgg


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search